Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000015656 (Hspa8)
Chromosomal location
Chr 9: 40609318 - 40613283 (+)
Description
heat shock protein 8 Gene [Source:MGI (curated);Acc:Hspa8-009]
RefSeq_dna
NM_031165 
RefSeq_peptide
NP_112442.2 
UniGene
Mm.467289 Mm.467540 Mm.469256 Mm.472965 Mm.290774 Mm.336743 
MGI
MGI:105384 
Uniprot/SWISSPROT
P63017 
Uniprot/SPTREMBL
Q3UBR0 Q3UXU1 Q504P4 Q9QZ38 Q3KQJ4 Q3TB63 Q3TEK2 Q3TF16 Q3TH04 Q3TH56 Q3TQ13 Q3TRH3 Q3TZJ3 Q3U9L2 Q3UBA6 Q3UDS0 Q3ULM1 
Human Ortholog
ENSG00000109971 (HSPA8)
Omim not available
UniTrap UNI2623
Vector Insertion
Chr 9: 40609384 - 40609432
Public Clones XR0493 (sanger) P109D11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23630
Vector Insertion
Chr 9: 40609432 - 40610000
Public Clones (sanger) IST14187D3 (tigm)
Private Clones OST250991 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26865
Vector Insertion
Chr 9: 40610975 - 40611056
Public Clones not available
Private Clones OST90436 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15635
Vector Insertion
Chr 9: 40612447 - 40612545
Public Clones PST9449-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000117557
Sequence
GGCATTTGTGTGGTCTCGTCGTCAGCGCAGCTGGGCCTACACACAAG - UNI2623 - - UNI23630 - CAACCATGTCTAAGGGACCTGCAGTTG

GCATTGATCTCGGCACCACCTACTCCTGTGTGGGTGTCTTCCAGCATGGAAAGGTGGAAATTATTGCCAATGACCAGGGTAACCGCACCACGCCAAGCTA

TGTTGCTTTCACGGACACAGAGAGATTAATTGGGGATGCGGCCAAGAATCAGGTTGCAATGAACCCCACCAACACAGTTTTTG ATGCCAAACGTCTGAT

CGGGCGTAGGTTTGATGATGCTGTTGTTCAGTCTGATATGAAGCACTGGCCCTTCATGGTGGTGAATGATGCAGGCAGGCCCAAGGTCCAAGTGGAATAC

AAAGGGGAGACAAAAAGTTTCTACCCAGAGGAAGTGTCCTCCATGGTTCTGACAAAGATGAAGGAAATTGCAGAAGCGTACCTCGGAAAG GCAACAAAA

GATGCTGGAACTATTGCTGGCCTCAATGTACTTCGAATCATCAATGAACCAACTGCTGCTGCTATTGCTTACGGCTTAGATAAGAAG - UNI26865 -

 GTCGGAGCTGAAAGGAATGTGCTCATTTTTGACTTGGGAGGTGGCACTTTTGATGTGTCAATCCTCACTATTGAGGATGGAATTTTTGAGGTCAAATCA

ACAGCTGGAGACACCCACTTAGGTGGAGAAGATTTTGACAACCGAATGGTCAATCATTTCATTGCTGAGTTCAAGCGAAAGCACAAGAAAGACATCAGTG

AGAACAAGAGAGCTGTCCGCCGTCTCCGCACGGCCTGCGAGCGGGCCAAGCGCACCCTCTCCTCCAGCACCCAGGCCAGTATTGAGATTGATTCTCTCTA

TGAGGGAATTGACTTCTATACCTCCATTACCCGGGCTCGATTTGAGGAGTTGAATGCTGACCTGTTCCGTGGCACACTGGACCCTGTAGAGAAGGCCCTT

CGAGATGCCAAGCTGGACAAGTCACAGATCCATGATATTGTCTTGGTGGGTGGTTCTACCAGAATCCCCAAGATTCAGAAACTTCTGCAAGACTTCTTCA

ATGGAAAAGAGCTGAACAAGAGCATTAACCCCGATGAAGCTGTTGCCTATGGTGCAG CTGTCCAGGCAGCCATTCTATCTGGAGACAAGTCTGAGAACG

TTCAGGATTTGCTGCTCTTGGATGTCACTCCTCTTTCCCTTGGTATTGAAACTGCTGGCGGAGTCATGACTGTCCTCATCAAGCGCAATACCACCATCCC

CACCAAGCAGACACAGACTTTCACCACCTACTCTGACAACCAGCCTGGTGTACTCATTCAG GTGTATGAAGGTGAAAGGGCCATGACCAAGGACAACAA

CCTGCTTGGAAAGTTCGAGCTCACAGGCATCCCTCCAGCACCCCGTGGGGTCCCTCAGATTGAGGTTACTTTTGACATCGATGCCAATGGCATCCTCAAT

GTTTCTGCTGTAGATAAGAGCACAGGAAAGGAGAACAAGATCACCATCACCAATGACAAGG - UNI15635 - GCCGCTTGAGTAAGGAAGATATTGA

GCGCATGGTCCAAGAAGCTGAGAAGTACAAGGCTGAGGATGAGAAGCAGAGAGATAAGGTTTCCTCCAAGAACTCACTGGAGTCCTATGCCTTCAACATG

AAAGCAACTGTGGAAGATGAGAAACTTCAAGGCAAGATCAATGATGAGGACAAACAGAAGATTCTTGACAAGTGCAATGAAATCATCAGCTGGCTGGATA

AGAACCAG ACTGCAGAGAAGGAAGAATTTGAGCATCAGCAGAAAGAACTGGAGAAAGTCTGCAACCCTATCATTACCAAGCTGTACCAGAGTGCAGGTG

GCATGCCTGGGGGAATGCCTGGTGGCTTCCCAGGTGGAGGAGCTCCCCCATCTGGTGGTGCTTCTTCAGGCCCCACCATTGAAGAGGTGGATTAAGTCAG

TCCAAGAAGGTGTAGCTTTGTTCCACAGGGACCCAAAACAAGTAACATGGAATAATAAAACTATTTAAATTGGCACCA
Translation
 - UNI2623 - - UNI23630 - MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFD DAKR

LIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGK ATKDAGTIAGLNVLRIINEPTAAAIAYGLDKK -

 UNI26865 - VGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSS

STQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAA A

VQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQ VYEGERAMTKDNNLLGKFELTGIPPAPRGVPQ

IEVTFDIDANGILNVSAVDKSTGKENKITITNDKG - UNI15635 - GRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKL

QGKINDEDKQKILDKCNEIISWLDKNQ TAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
Transcript ENSMUST00000015800
Sequence
CTCATTGAACGCGGAGGCAGCTGCCTGGCATTTGTGTGGTCTCGTCGTCAGCGCAGCTGGGCCTACACACAAG - UNI2623 - - UNI23630 - C

AACCATGTCTAAGGGACCTGCAGTTGGCATTGATCTCGGCACCACCTACTCCTGTGTGGGTGTCTTCCAGCATGGAAAGGTGGAAATTATTGCCAATGAC

CAGGGTAACCGCACCACGCCAAGCTATGTTGCTTTCACGGACACAGAGAGATTAATTGGGGATGCGGCCAAGAATCAGGTTGCAATGAACCCCACCAACA

CAGTTTTTG ATGCCAAACGTCTGATCGGGCGTAGGTTTGATGATGCTGTTGTTCAGTCTGATATGAAGCACTGGCCCTTCATGGTGGTGAATGATGCAG

GCAGGCCCAAGGTCCAAGTGGAATACAAAGGGGAGACAAAAAGTTTCTACCCAGAGGAAGTGTCCTCCATGGTTCTGACAAAGATGAAGGAAATTGCAGA

AGCGTACCTCGGAAAG ACCGTTACCAACGCTGTGGTCACAGTGCCCGCTTACTTCAATGACTCTCAGCGACAGGCAACAAAAGATGCTGGAACTATTGC

TGGCCTCAATGTACTTCGAATCATCAATGAACCAACTGCTGCTGCTATTGCTTACGGCTTAGATAAGAAG - UNI26865 - GTCGGAGCTGAAAGGA

ATGTGCTCATTTTTGACTTGGGAGGTGGCACTTTTGATGTGTCAATCCTCACTATTGAGGATGGAATTTTTGAGGTCAAATCAACAGCTGGAGACACCCA

CTTAGGTGGAGAAGATTTTGACAACCGAATGGTCAATCATTTCATTGCTGAGTTCAAGCGAAAGCACAAGAAAGACATCAGTGAGAACAAGAGAGCTGTC

CGCCGTCTCCGCACGGCCTGCGAGCGGGCCAAGCGCACCCTCTCCTCCAGCACCCAGGCCAGTATTGAGATTGATTCTCTCTATGAGGGAATTGACTTCT

ATACCTCCATTACCCGGGCTCGATTTGAGGAGTTGAATGCTGACCTGTTCCGTGGCACACTGGACCCTGTAGAGAAGGCCCTTCGAGATGCCAAGCTGGA

CAAGTCACAGATCCATGATATTGTCTTGGTGGGTGGTTCTACCAGAATCCCCAAGATTCAGAAACTTCTGCAAGACTTCTTCAATGGAAAAGAGCTGAAC

AAGAGCATTAACCCCGATGAAGCTGTTGCCTATGGTGCAG CTGTCCAGGCAGCCATTCTATCTGGAGACAAGTCTGAGAACGTTCAGGATTTGCTGCTC

TTGGATGTCACTCCTCTTTCCCTTGGTATTGAAACTGCTGGCGGAGTCATGACTGTCCTCATCAAGCGCAATACCACCATCCCCACCAAGCAGACACAGA

CTTTCACCACCTACTCTGACAACCAGCCTGGTGTACTCATTCAG GTGTATGAAGGTGAAAGGGCCATGACCAAGGACAACAACCTGCTTGGAAAGTTCG

AGCTCACAGGCATCCCTCCAGCACCCCGTGGGGTCCCTCAGATTGAGGTTACTTTTGACATCGATGCCAATGGCATCCTCAATGTTTCTGCTGTAGATAA

GAGCACAGGAAAGGAGAACAAGATCACCATCACCAATGACAAGG - UNI15635 - GCCGCTTGAGTAAGGAAGATATTGAGCGCATGGTCCAAGAAG

CTGAGAAGTACAAGGCTGAGGATGAGAAGCAGAGAGATAAGGTTTCCTCCAAGAACTCACTGGAGTCCTATGCCTTCAACATGAAAGCAACTGTGGAAGA

TGAGAAACTTCAAGGCAAGATCAATGATGAGGACAAACAGAAGATTCTTGACAAGTGCAATGAAATCATCAGCTGGCTGGATAAGAACCAG ACTGCAGA

GAAGGAAGAATTTGAGCATCAGCAGAAAGAACTGGAGAAAGTCTGCAACCCTATCATTACCAAGCTGTACCAGAGTGCAGGTGGCATGCCTGGGGGAATG

CCTGGTGGCTTCCCAGGTGGAGGAGCTCCCCCATCTGGTGGTGCTTCTTCAGGCCCCACCATTGAAGAGGTGGATTAAGTCAGTCCAAGAAGGTGTAGCT

TTGTTCCACAGGGACCCAAAACAAGTAACATGGAATAATAAAACTATTTAAATTGGCACC
Translation
 - UNI2623 - - UNI23630 - MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFD DAKR

LIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGK TVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLR

IINEPTAAAIAYGLDKK - UNI26865 - VGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENK

RAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGK

ELNKSINPDEAVAYGAA AVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQ VYEGERAMTKDNN

LLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKG - UNI15635 - GRLSKEDIERMVQEAEKYKAEDEKQRDKVSSK

NSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQ TAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASS

GPTIEEVD
Transcript ENSMUST00000117870
Sequence
AAGACAGGGTATAAGAGAGAGGGAAGCGGGCGGAAACCGGTCTCATTGAACGCGGAGGCAGCTGCCTGGCATTTGTGTGGTCTCGTCGTCAGCGCAGCTG

GGCCTACACACAAG - UNI2623 - - UNI23630 - CAACCATGTCTAAGGGACCTGCAGTTGGCATTGATCTCGGCACCACCTACTCCTGTGTGG

GTGTCTTCCAGCATGGAAAGGTGGAAATTATTGCCAATGACCAGGGTAACCGCACCACGCCAAGCTATGTTGCTTTCACGGACACAGAGAGATTAATTGG

GGATGCGGCCAAGAATCAGGTTGCAATGAACCCCACCAACACAGTTTTTG ATGCCAAACGTCTGATCGGGCGTAGGTTTGATGATGCTGTTGTTCAGTC

TGATATGAAGCACTGGCCCTTCATGGTGGTGAATGATGCAGGCAGGCCCAAG - UNI15635 - - UNI26865 - GTGGCATGCCTGGGGGAATGC

CTGGTGGCTTCCCAGGTGGAGGAGCTCCCCCATCTGGTGGTGCTTCTTCAGGCCCCACCATTGAAGAGGTGGATTAAGTCAGTCCAAGAAGGTGTAGCTT

TGTTCCACAGGGACCCAAAACAAGTAACATGGAATAATAAAACTATTTAAATTGGCACCA
Translation
 - UNI2623 - - UNI23630 - MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFD DAKR

LIGRRFDDAVVQSDMKHWPFMVVNDAGRPK - UNI15635 - - UNI26865 - VACLGECLVASQVEELPHLVVLLQAPPLKRWIKSVQEGVALFH

RDPKQVTWNNKTI

For any suggestions or comments, please send an email to unitrap@crg.es