Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000015659 (Serac1)
Chromosomal location
Chr 17: 6040718 - 6079741 (-)
Description
serine active site containing 1 Gene [Source:MGI (curated);Acc:Serac1-001]
RefSeq_dna
NM_177311 
RefSeq_peptide
NP_796285.2 NP_001104487.1 
MGI
MGI:2447813 
Uniprot/SWISSPROT
Q3U213 
Human Ortholog
ENSG00000122335 (SERAC1)
Omim not available
UniTrap UNI32467
Vector Insertion
Chr 17: 6074155 - 6079674
Public Clones IST12300E1 (tigm) IST13202B4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33407
Vector Insertion
Chr 17: 6056606 - 6060366
Public Clones IST11186F9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000024570
Sequence
GGGGTCACGTGCTCACTGCCGCTGGGTTAGGGCGCAGGTTACTAGTGGTGGCGGAGGGTGAGCTCTGTAGCCGGCGGAGTCCACCGCGAGCCGTCCGGGC

TGCCAGAGTCATTGCGCCGGCAG - UNI32467 - GATGTCCCTGGCTGCCTACTGTGTCATCTGTTGCAGGAGGATAGGATCCTTTGCTCCCCGATC

AAAAAGTCGCACGCCCTGGAGAAATATCC - UNI32467 - GAAATATAATAAGATTTACTGGATCCCTCATTGTAGG GGGTTCTCTATTTATTACA

TATGAAGTGCTGGCCCTGAAAAAGTCTTTAATGTTGGACACTCAGGTGGTGGAACGAGAAAAAATGAAGTCTTACATCTATGTGCACAAAGCTCCTGTAG

ACAGGTTAGACAACCGTG ACTCTTTCAGCACAGTTGACATAGAAGATCATGACTGTGCAGTGTGGCTGCTCCTGAGGAAGAGCCGGGAGGACGATCTAG

CTGCACGGCTGCAGGCCGTGCGTGAAATGTCAGAGGCTCACCACTGGCATG ACTACCAGTACAGGATAATTGCTCAAGCCTGTGACCCGAGGACCCTTA

TTGGTTTGGCACGAAGCAAAGAAAGTGATCTTCGGTTTTTTCTCCCACCCCCTCCTTTGCCTTCTTTAAAAGAA GACTCCTCCACTGAAGAGGAACTCA

GGCATCTGCTGGCCTCTCTGCCTCAGACAGAGCTTGATGAGTGTCTCCAGTACTTTACATCCTTGGCTCTTAGTGAAAGCAGCCAGAGCCTGGCTGCACA

GAAG GGAGGACTGTGGTGTTTTGGAGGAAACGGACTGCCTTACGCAGAAAGCTTTGGAAAGGTTCCCTCAGCCACAGTGGAAATGTTCTGTTTAGAAGC

CATAGTAAAGCATTCGGAG - UNI33407 - ATACCCTCACACTGTGACCACATTGAAGCAGGCGGTGGCTTGCAACTCCTGCAGAGGCTCTACCAGC

TTCACAAGGACTGCCCCAAAGTACAGAGAAACGTCATGAGGATCATCGGAAACATGGCTTTGAACGAGCATCTTCACCCTGCTATAGTCCACTCAG - U

NI33407 - GATGGGTATCTCTCATGGCAGAAGCCTTGAAGTCCAGCCACATTATGGAGGCTTCCCACGCTGCCAGAACCCTGGCTAACCTGGACCGAG

AAACTGTGGGTGAGAAATACCAGGACGGAGTGTACGTGCTGCATCCCCAGTGTCGGACAAG - UNI33407 - TCAGCCCATTAAAGCCGATGTCCTT

TTTATTCATGGCCTAATGGGAGCAGCATTTAAAACCTGGCGGCAGCACGACAGCCAGCGGGCTCTGACTGAAAGTGCTGTGGTGGATGAAGACAGGTACA

CTACATGCTGGCCCAAG ACATGGCTAGCAAAGGACTGCCCCTCACTTCGCATCATATCTGTGGAGTACGACACGAGTCTCAGCGACTGGAGGGCAAGGT

GCCCTATGGAGAG AAAGTCGATTGCATTCAGAAGCAACGAACTTCTCAGCAAGCTCAGGGCTGCTGGTGTTGGGGATAGGCCAATGATTTGGATCTCAC

ACAGCATGGGAG GTCTTCTTGTGAAGAAGATGCTGTTGGAAGCCTCTAAGAAGCCCGAACTGAATGCTCTTATAAACAATACCAGAGGAATTATTTTTT

ACAGTGTCCCTCACCATGGGTCACGTTTGGCTGAATACTCCGTTAATATTCGATATCTTCTCTTTCCCTCACTGGAAGTCAAAGAACTCAGCAAAG ACT

CTCCTGCACTGAAGACGCTACAGGACGACTTTCTGGAGTTCGCGAAAGACAAAAACTTCCAGGTGCTGAACTTTGTAGAAACACAACCGACATTTATCGG

CAGCATGATTAAACTGCATGTAGTGCCCGTGGAGTCAGCAG ATTTAGGCATTGGGGATCTAATTCCTGTGGACGTCAACCACTTGAACATTTGCAAGCC

GAAGACAAAGGATGCGTTTTTGTACCAACGTACTCTACAGTTCATCTGCGAAACTTTAGCCAGAGATCTTGAAAACTGAGAGATACGTTCTTCCATTTTT

TTGTGTGAATATAGTGCGAGAAACGTG
Translation
 - UNI32467 - MSLAAYCVICCRRIGSFAPRSKSRTPWRNIR - UNI32467 - RNIIRFTGSLIVG GGSLFITYEVLALKKSLMLDTQVVERE

KMKSYIYVHKAPVDRLDNRD DSFSTVDIEDHDCAVWLLLRKSREDDLAARLQAVREMSEAHHWHD DYQYRIIAQACDPRTLIGLARSKESDLRFFLPP

PPLPSLKE DSSTEEELRHLLASLPQTELDECLQYFTSLALSESSQSLAAQK GGLWCFGGNGLPYAESFGKVPSATVEMFCLEAIVKHSE - UNI334

07 - IPSHCDHIEAGGGLQLLQRLYQLHKDCPKVQRNVMRIIGNMALNEHLHPAIVHSG - UNI33407 - GWVSLMAEALKSSHIMEASHAARTLA

NLDRETVGEKYQDGVYVLHPQCRTS - UNI33407 - SQPIKADVLFIHGLMGAAFKTWRQHDSQRALTESAVVDEDRYTTCWPK TWLAKDCPSLRI

ISVEYDTSLSDWRARCPMER RKSIAFRSNELLSKLRAAGVGDRPMIWISHSMGG GLLVKKMLLEASKKPELNALINNTRGIIFYSVPHHGSRLAEYSV

NIRYLLFPSLEVKELSKD DSPALKTLQDDFLEFAKDKNFQVLNFVETQPTFIGSMIKLHVVPVESAD DLGIGDLIPVDVNHLNICKPKTKDAFLYQRT

LQFICETLARDLEN
Transcript ENSMUST00000097432
Sequence
GGGGTCACGTGCTCACTGCCGCTGGGTTAGGGCGCAGGTTACTAGTGGTGGCGGAGGGTGAGCTCTGTAGCCGGCGGAGTCCACCGCGAGCCGTCCGGGC

TGCCAGAGTCATTGCGCCGGCAG - UNI32467 - GATGTCCCTGGCTGCCTACTGTGTCATCTGTTGCAGGAGGATAGGATCCTTTGCTCCCCGATC

AAAAAGTCGCACGCCCTGGAGAAATATCC - UNI32467 - GAAATATAATAAGATTTACTGGATCCCTCATTGTAGG GGGTTCTCTATTTATTACA

TATGAAGTGCTGGCCCTGAAAAAGTCTTTAATGTTGGACACTCAGGTGGTGGAACGAGAAAAAATGAAGTCTTACATCTATGTGCACAAAGCTCCTGTAG

ACAGGTTAGACAACCGTG GGATTGTTTGGCAGGCAAGAAAAGAACTTCACAGAGCAGTAAGAAAACTGTTGGCGGCAGCAGCCAAGGTACTGCGGAGCC

CATTTGCTG ACTCTTTCAGCACAGTTGACATAGAAGATCATGACTGTGCAGTGTGGCTGCTCCTGAGGAAGAGCCGGGAGGACGATCTAGCTGCACGGC

TGCAGGCCGTGCGTGAAATGTCAGAGGCTCACCACTGGCATG ACTACCAGTACAGGATAATTGCTCAAGCCTGTGACCCGAGGACCCTTATTGGTTTGG

CACGAAGCAAAGAAAGTGATCTTCGGTTTTTTCTCCCACCCCCTCCTTTGCCTTCTTTAAAAGAA GACTCCTCCACTGAAGAGGAACTCAGGCATCTGC

TGGCCTCTCTGCCTCAGACAGAGCTTGATGAGTGTCTCCAGTACTTTACATCCTTGGCTCTTAGTGAAAGCAGCCAGAGCCTGGCTGCACAGAAG GGAG

GACTGTGGTGTTTTGGAGGAAACGGACTGCCTTACGCAGAAAGCTTTGGAAAGGTTCCCTCAGCCACAGTGGAAATGTTCTGTTTAGAAGCCATAGTAAA

GCATTCGGAG - UNI33407 - ATACCCTCACACTGTGACCACATTGAAGCAGGCGGTGGCTTGCAACTCCTGCAGAGGCTCTACCAGCTTCACAAGG

ACTGCCCCAAAGTACAGAGAAACGTCATGAGGATCATCGGAAACATGGCTTTGAACGAGCATCTTCACCCTGCTATAGTCCACTCAG - UNI33407 -

 GATGGGTATCTCTCATGGCAGAAGCCTTGAAGTCCAGCCACATTATGGAGGCTTCCCACGCTGCCAGAACCCTGGCTAACCTGGACCGAGAAACTGTGG

GTGAGAAATACCAGGACGGAGTGTACGTGCTGCATCCCCAGTGTCGGACAAG - UNI33407 - TCAGCCCATTAAAGCCGATGTCCTTTTTATTCAT

GGCCTAATGGGAGCAGCATTTAAAACCTGGCGGCAGCACGACAGCCAGCGGGCTCTGACTGAAAGTGCTGTGGTGGATGAAGACAGGTACACTACATGCT

GGCCCAAG ACATGGCTAGCAAAGGACTGCCCCTCACTTCGCATCATATCTGTGGAGTACGACACGAGTCTCAGCGACTGGAGGGCAAGGTGCCCTATGG

AGAG AAAGTCGATTGCATTCAGAAGCAACGAACTTCTCAGCAAGCTCAGGGCTGCTGGTGTTGGGGATAGGCCAATGATTTGGATCTCACACAGCATGG

GAG GTCTTCTTGTGAAGAAGATGCTGTTGGAAGCCTCTAAGAAGCCCGAACTGAATGCTCTTATAAACAATACCAGAGGAATTATTTTTTACAGTGTCC

CTCACCATGGGTCACGTTTGGCTGAATACTCCGTTAATATTCGATATCTTCTCTTTCCCTCACTGGAAGTCAAAGAACTCAGCAAAG ACTCTCCTGCAC

TGAAGACGCTACAGGACGACTTTCTGGAGTTCGCGAAAGACAAAAACTTCCAGGTGCTGAACTTTGTAGAAACACAACCGACATTTATCGGCAGCATGAT

TAAACTGCATGTAGTGCCCGTGGAGTCAGCAG ATTTAGGCATTGGGGATCTAATTCCTGTGGACGTCAACCACTTGAACATTTGCAAGCCGAAGACAAA

GGATGCGTTTTTGTACCAACGTACTCTACAGTTCATCTGCGAAACTTTAGCCAGAGATCTTGAAAACTGAGAGATACGTTCTTCCATTTTTTTGTGTGAA

TATAGTGCGAGAAACGTG
Translation
 - UNI32467 - MSLAAYCVICCRRIGSFAPRSKSRTPWRNIR - UNI32467 - RNIIRFTGSLIVG GGSLFITYEVLALKKSLMLDTQVVERE

KMKSYIYVHKAPVDRLDNRG GIVWQARKELHRAVRKLLAAAAKVLRSPFAD DSFSTVDIEDHDCAVWLLLRKSREDDLAARLQAVREMSEAHHWHD D

YQYRIIAQACDPRTLIGLARSKESDLRFFLPPPPLPSLKE DSSTEEELRHLLASLPQTELDECLQYFTSLALSESSQSLAAQK GGLWCFGGNGLPYAE

SFGKVPSATVEMFCLEAIVKHSE - UNI33407 - IPSHCDHIEAGGGLQLLQRLYQLHKDCPKVQRNVMRIIGNMALNEHLHPAIVHSG - UNI33

407 - GWVSLMAEALKSSHIMEASHAARTLANLDRETVGEKYQDGVYVLHPQCRTS - UNI33407 - SQPIKADVLFIHGLMGAAFKTWRQHDSQR

ALTESAVVDEDRYTTCWPK TWLAKDCPSLRIISVEYDTSLSDWRARCPMER RKSIAFRSNELLSKLRAAGVGDRPMIWISHSMGG GLLVKKMLLEAS

KKPELNALINNTRGIIFYSVPHHGSRLAEYSVNIRYLLFPSLEVKELSKD DSPALKTLQDDFLEFAKDKNFQVLNFVETQPTFIGSMIKLHVVPVESAD

 DLGIGDLIPVDVNHLNICKPKTKDAFLYQRTLQFICETLARDLEN
Transcript ENSMUST00000115780
Sequence
AGCCGGCGGAGTCCACCGCGAGCCGTCCGGGCTGCCAGAGTCATTGCGCCGGCAG - UNI32467 - GATGTCCCTGGCTGCCTACTGTGTCATCTGT

TGCAGGAGGATAGGATCCTTTGCTCCCCGATCAAAAAGTCGCACGCCCTGGAGAAATATCC - UNI32467 - GAAATATAATAAGATTTACTGGATC

CCTCATTGTAGG GGGTTCTCTATTTATTACATATGAAGTGCTGGCCCTGAAAAAGTCTTTAATGTTGGACACTCAGGTGGTGGAACGAGAAAAAATGAA

GTCTTACATCTATGTGCACAAAGCTCCTGTAGACAGGTTAGACAACCGTG GGATTGTTTGGCAGGCAAGAAAAGAACTTCACAGAGCAGTAAGAAAACT

GTTGGCGGCAGCAGCCAAGGTACTGCGGAGCCCATTTGCTG ACTCTTTCAGCACAGTTGACATAGAAGATCATGACTGTGCAGTGTGGCTGCTCCTGAG

GAAGAGCCGGGAGGACGATCTAGCTGCACGGCTGCAGGCCGTGCGTGAAATGTCAGAGGCTCACCACTGGCATG ACTACCAGTACAGGATAATTGCTCA

AGCCTGTGACCCGAGGACCCTTATTGGTTTGGCACGAAGCAAAGAAAGTGATCTTCGGTTTTTTCTCCCACCCCCTCCTTTGCCTTCTTTAAAAGAA GA

CTCCTCCACTGAAGAGGAACTCAGGCATCTGCTGGCCTCTCTGCCTCAGACAGAGCTTGATGAGTGTCTCCAGTACTTTACATCCTTGGCTCTTAGTGAA

AGCAGCCAGAGCCTGGCTGCACAGAAG GGAGGACTGTGGTGTTTTGGAGGAAACGGACTGCCTTACGCAGAAAGCTTTGGAAAGGTTCCCTCAGCCACA

GTGGAAATGTTCTGTTTAGAAGCCATAGTAAAGCATTCGGAG - UNI33407 - ATACCCTCACACTGTGACCACATTGAAGCAGGCGGTGGCTTGCA

ACTCCTGCAGAGGCTCTACCAGCTTCACAAGGACTGCCCCAAAGTACAGAGAAACGTCATGAGGATCATCGGAAACATGGCTTTGAACGAGCATCTTCAC

CCTGCTATAGTCCACTCAG - UNI33407 - CATGGGACCGGTGATGACTGACTGAAACCTTGGGCAGCAGACATCTTTTCTCCTTGACCTCTGCTGC

CCAGGTGTTTGTCATCGAGGTGAACATGCTTTAAAACTGCGATCTGAAAAGAGCTGTCTAGTGTATTGCTAAATTAGTGTTAGTGTTTCTCTGACAAGAC

AGTCGGCATTTCTGCTCTGTCTATATGATGGAAAGGCCACTCTCCATTTATCACAAAGGCTTGGTGAGGCGTAGATGATAACGTACACCAAGGTGGATAA

TAGAGCAAGATGGAACAAATCCAACACTGGCGGAATCATCCTGAACAAAGACATCATTGAAACCAATGAGCACAAGATAACTGCAAAACAGCAGCGCCTT

AAAGACGGCACAGACACACGGTAGCTGCAGAAGGACCCCTCAAAGGCAAGGAACCCTCCTACCTCACCTACCTCACCTAAGCTGCCCTTGAGACTAGTGT

GGGCATAATGAACAGATGTGGTCAGGGGCAGGAACTCAAGCGTTGGCGAAGCCTGACATTTGCTCTGCCTGAGTTCATGTAAATTAGAATGTGATGGAAC

GGCCTGGAACATAATCTGGTATTTTATCATAAATGCACATAGATTTCTGAATAATGCTGATGATAATTTATGGGTACATTTGGAGGATCTACAAACAATC

CACAACTAAAAATATTTTGGTGAAGAGAGGCCCTTACGTTCCTGTCACAGGGTCAGAGACAGCAAGGATGAAGTTGCTGGGAATTTGAGTTGGGAGGTGC

ATGGGAGCAAGGATCAAGGTCTTTCTTGGGCAGAGAAACAGCTCTGATACTGCAACATAGACGTTATACCGTGCAGGGAGCGAAGCTGAATGTGGAGCCA

GGGCCATCAGAGGTGATGGTGTCAGCATGGGGTCATTAGTTGTAGACATCCTAGGGCAGGGCATCTCGGGAGCTCCCTGTGGGAACAGGTAAGTGTTCGG

GAACCCTTAACTTTAATTTCCCGCTGACACTACTCTTACTCAGTATACCGCTGAGCCCATCCCCTGCCACCTTGGTATAAAGATCCCACAGTCTGCTGAT

TCCTCTCTTGGCCAGGTCTGAACAACACAGAGAGAAATCTTACTGGTTTACCATTTTGAAATTACCAGTATATTCTTAATCCTGAGAGACACAATATGAG

TAACTATGTTCTGTGAATAAGCTTAGAATAAACGTGTCCCATCTGTTTCCATGAAAAAATGTATATAAAGCATCCTCAGAGCCCATCTATTCCACAGAGT

GTTGTAAGGGCCTTGCCCGAGTCTCACTGTGTGTGTGGTGTCAGCGATCATGATAGCGGCTCTCACACAATTCTCTATTCACATATAATTGCTGTGTGTG

TGTTTGTGTGTGCGTGTGTGCATGTAGCTCAGCGGGCAACAGTCAGGAGTTAGTTCTTCCACCATGTGAGTCTTGGGGCTCAAACTCAGGTCTTCAGGCC

TGACAGCAAGCACCTCTGATGCTCAGCCACCCCTTGGGCCTTAAGCCATAATTGATAATCTATCTTATTCTCTTGCTTTTCAACCAATTGTTGAGTCCCA

ATTGTTGAGAGATTGAGAGAGAGAACCAAAACAGCATGCAGTAAGAACTATCTATTGCATTTGATATCGAGGAAGGCTGGCCAAAAGAATCCGAGGAGCC

CCTTCAGATCTGAAAAGACTCAATTTTAAAAGAACGAAAACATCTAACGCATCCAACATGAGAACAAATTACCAATCAAGATACACTGCAGGCTTTGACT

GGTCACTGATCTCTGGGTATAAGTTTCCCTTTCCGACAAAACGACCATTTGAAAGCCAGCGCTTTAACAATGTGTAATTAGCTTACACATGTCGTCAGGG

AGATTTTTTTTAAGTATCTCAAACTAGCAACTTTAAACCTTTGTATTTCAGTCACCTTAACAAATATCTTTAGCTCTGGGAAATGAGTCTATATTACCGT

CAGCGAGACTGAACTTGTCAGCATTGCCCCTGAAATACTGTGCTAAAAACGTGCAGTCATCGTAACTAAGGCAGACCAAAAGCCAAAACAGACTGGACAC

AAAATGGAATCTTTGGGTGGTGGTTGCTCACTGCTGAAGTCATTCAACCAACAGATGCTAGCTTAAAACGCCCTACAGTTAAACATTGGTTTAAAAATAA

GGCTATTCCAACTGTTGTCCTGTTCCCCACCC
Translation
 - UNI32467 - MSLAAYCVICCRRIGSFAPRSKSRTPWRNIR - UNI32467 - RNIIRFTGSLIVG GGSLFITYEVLALKKSLMLDTQVVERE

KMKSYIYVHKAPVDRLDNRG GIVWQARKELHRAVRKLLAAAAKVLRSPFAD DSFSTVDIEDHDCAVWLLLRKSREDDLAARLQAVREMSEAHHWHD D

YQYRIIAQACDPRTLIGLARSKESDLRFFLPPPPLPSLKE DSSTEEELRHLLASLPQTELDECLQYFTSLALSESSQSLAAQK GGLWCFGGNGLPYAE

SFGKVPSATVEMFCLEAIVKHSE - UNI33407 - IPSHCDHIEAGGGLQLLQRLYQLHKDCPKVQRNVMRIIGNMALNEHLHPAIVHSA - UNI33

407 - AWDR

For any suggestions or comments, please send an email to unitrap@crg.es