Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000015697 (Setdb1)
Chromosomal location
Chr 3: 95127447 - 95161122 (-)
Description
SET domain, bifurcated 1 Gene [Source:MGI (curated);Acc:Setdb1-005]
RefSeq_dna
NM_018877 
RefSeq_peptide
NP_061365.2 
MGI
MGI:1934229 
Uniprot/SWISSPROT
O88974 
Human Ortholog
ENSG00000143379 (SETDB1)
Omim not available
UniTrap UNI20719
Vector Insertion
Chr 3: 95160125 - 95160986
Public Clones (sanger) IST14470A2 (tigm)
Private Clones OST353809 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26429
Vector Insertion
Chr 3: 95153796 - 95158463
Public Clones not available
Private Clones OST118842 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2280
Vector Insertion
Chr 3: 95152018 - 95153760
Public Clones AG0663 (sanger) RRK370 (baygenomics) IST14479B11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27883
Vector Insertion
Chr 3: 95145769 - 95149447
Public Clones (sanger) 5SE386G12 (ggtc) CMHD-GT_475C6-3 (cmhd)
Private Clones OST45290 (lexicon) OST39844 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19384
Vector Insertion
Chr 3: 95145386 - 95145577
Public Clones not available
Private Clones OST392642 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14795
Vector Insertion
Chr 3: 95144083 - 95145386
Public Clones PST14822-NR (escells) PST14715-NL (escells) PST10327-NR (escells) PST13357-NL (escells)
PST8590-NR (escells) PST11761-NL (escells) PST3092-NL (escells) PST13370-NR (escells)
PST11197-NR (escells) PST13225-NR (escells) PST63-3 (escells) PST14729-NL (escells)
PST44 (escells) PST10559-NR (escells) PST3092-NR (escells) PST12049-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27498
Vector Insertion
Chr 3: 95143988 - 95144083
Public Clones not available
Private Clones OST58021 (lexicon)
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21753
Vector Insertion
Chr 3: 95141188 - 95142267
Public Clones not available
Private Clones OST318968 (lexicon)
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5751
Vector Insertion
Chr 3: 95128113 - 95128226
Public Clones CSI466 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30346
Vector Insertion
Chr 3: 95127463 - 95128113
Public Clones CMHD-GT_407G9-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000015841
Sequence
TTTCCCCTCCCCCGCCGTCTCTCCTTCAGTTTGCCTGGGTTTGGCAAGGCGGAGCCCTGGAGTAAAACCTGGGGTCGGGGTTGTGAGACGCGGCCCTTGC

GGTCGGGCGCCAGAGTTGTGGGGAGGACGGACTGAGGTGCGCTGAGGCCGAGGTGGACCTGGGAGGCTTGGCTG - UNI20719 - GGCCAAAGCATG

TCCTCCCTCCCTGGGTGCATGAGTTTGGCTGCAGCGCCAGCTGCAGCTGACTCTGCAGAGATTGCTGAGCTGCAGCAGGCGGTGGTTGAAGAGCTGGGTA

TCTCTATGGAGGAACTTCGTCAGTACATTGATGAGGAACTGGAAAAGATGGACTGCATACAGCAGCGCAAGAAGCAGCTCGCAGAGCTGGAGACGTGGGT

ACTACAGAAAGAGTCTGAAGTGGCTTATGTTGATCGGCTGTTTGATGATGCATCCAG GGAAGTGACTAACTGTGAGTCTTTGGTGAAGGATTTCTACTC

TAAGCTGGGACTACAGTATCATGACAGTAGCTCTGAGGATGAAGCTTCCCGGCCCACAGAGATCATTGAGATTCCTGATGAAGATGATGATGTCCTCAGT

ATTGATTCAG - UNI26429 - GTGATGCTGGGAGCAGAACTCCAAAAGACCAGAAG - UNI2280 - CTTCGTGAAGCTATGGCTGCCTTAAGAA

AATCAGCTCAAGATGTCCAGAAGTTCATGGATGCTGTCAACAAGAAAAGCAGTTCTCAAGATCTACATAAAG GAACCTTGGGTCAGGTGTCTGGAGAAC

TGAGCAAAGATGGGGACCTGATAGTCAGCATGCGGATTCTGGGCAAGAAGAGGACTAAGACATGGCACAAAGGCACCCTTATTGCCATCCAGACTGTTG 

GGCTAGGAAAAAAATACAAAGTGAAATTTGACAACAAAGGAAAGAGTCTGCTATCTGGGAACCATATTGCCTATGATTACCACCCTCCCGCTGACAAGCT

GTTTGTGGGCAGTCGAGTGGTGGCCAAGTACAAAGATGGAAATCAGGTCTGGCTTTATGCTGGCATTGTAGCTGAGACCCCTAACGTCAAGAACAAGCTC

AG ATTTTTAATTTTTTTTGATGATGGCTATGCTTCCTATGTCACTCAGTCAGAGCTTTATCCCATTTGCCGACCAC - UNI27883 - TAAAAAAGA

CTTGGGAGGACATAGAAGATAGCTCCTGCCGAGACTTCATAGAGGAATATATCACTGCCTATCCAAACCGCCCAATGGTACTTCTCAAGAGTGGGCAGCT

TATCAAGACTGAGTGGGAAGGCACATGGTGGAAGTCTCGAGTTGAAGAGGTGGATGGCAGCCTAGTCAGGATCCTCTTTCTG - UNI14795 - - UN

I19384 - GATGACAAAAGATGTGAGTGGATATATCGAGGCTCTACACGCCTGGAACCTATGTTTAGTATGAAGACATCCTCAGCCTCTGCAATGGAGA

AGAAGCAAGGGGGGCAACTCAGAACCCGTCCTAATATGG - UNI14795 - GTGCTGTGAGGAGCAAAGGTCCTGTTGTTCAGTATACACAGGATCTA

ACTGGTACTGGAATCCAGTTTAAGCCCATGGAGCCCCTACAGCCTATAGCTCCACCGGCCCCACTTCCTATACCTCCTCTTTCCCCCCAAGCAGCTGACA

CTGA - UNI14795 - - UNI27498 - AAGCTTAGAAAGCCAACTTGCACAATCACGGAAACAAGTAGCCAAGAAGAGCACATCATTCCGACCAGG

ATCTGTGGGCTCCGGCCATTCCTCCCCTACTTCATCCACACTCAGTGAAAATGTGTCTGCTGGGAAACTTGGGATAAACCAGACATATCG GTCACCTTT

GGCCTCAGTAACATCTACCCCAGCATCTGCAGCCCCTCCAGTCCCTCCAGTCCCACCAGGGCCTCCAACCCCTCCAGGGCCTCCAGCTCCTCCAGGGCCT

CTAGCTCCTCCAGCCTTCCATGGCATGTTAGAGCGGGCACCAGCTGAGCCCTCCTACCGAGCCCCCATGGAGAAGCTTTTCTATTTACCTCATGTCTGCA

GTTACACTTGTTTGTCCCGGATCAGACCCATGAGAAACGAACAGTATCGGGGCAAGAACCCTCTATTAGTTCCACTTCTGTATGACTTCCGGAGGATGAC

AGCACGGCGCAGAGTTAACCGCAAAATGGGCTTTCATGTAATCTATAAGACACCCTGTGGTCTCTGCCTTCGGACGATGCAGGAGATAGAGCGCTACCTT

TTTGAGACTGGCTGTGACTTTCTGTTCCTGGAGATGTTCTGTTTGGATCCATATGTTCTTGTTGACAGAAAGTTTCAACCCTTTAAGCCTTTTTACTATA

TTTTGGACATCACCTATGGCAAGGAAGATGTTCCCCTGTCCTGTGTTAATGAGATTGACACAACTCCCCCACCCCAGGTGGCCTACAGCAAGGAACGCAT

TCCTGGCAAGGGTGTTTTCATTAACACAGGCCCTGAATTTCTGGTTGGCTGTGACTGCAAGGATGGGTGTCGGGATAA - UNI21753 - ATCCAAAT

GTGCCTGCCACCAGCTAACTATCCAGGCCACAGCCTGTACCCCAGGGGGCCAAGTCAACCCTAACTCTGGCTACCAGTATAAAAGACTAGAAGAGTGTCT

GCCCACAGG GGTTTATGAGTGTAACAAACGCTGCAATTGTGACCCAAACATGTGCACAAATCGGTTGGTGCAGCATGGTCTGCAGGTTCGACTACAGCT

GTTTAAGACACAGAACAAGGGCTGGGGTATCCGCTGCTTGGATGATATTGCCAAAGGCTCTTTTGTCTGCATTTATGCAG GCAAAATCCTGACAGATGA

CTTTGCAGACAAAGAAGGCCTGGAGATGGGTGATGAGTACTTTGCAAATCTGGACCACATTGAAAGTGTGGAGAACTTCAAGGAAGGATATGAGAGTGAT

GTCCCCACTTCCTCTGACAGCAGTGGGGTAGATATGAAGGACCAGGAAGATGGCAACAGCGGTTCAGAGGACCCTGAAGAATCCAATGATGACAGCTCTG

ATGATAACTTCTGTAAGGATGAGGACTTCAGCACCAGTTCAGTGTGGCGTAGCTATGCTACCCGGAGGCAGACTCGGGGTCAAAAGGAGAATGAATTGTC

TGAGATGACTTCCAAGGACTCCCGCCCCCCAGACCTCGGGCCTCCACATGTTCCTATCCCTTCCTCAGTATCTGTAGGGGGCTGCAATCCACCTTCCTCT

GAAGAGACACCCAAGAACAAGGTGGCCTCGTGGTTGAGTTGCAATAGTGTCAGTGAAGGTGGATTTGCTGACTCTGACAGCCGTTCTTCCTTCAAGACTA

GTGAAGGTGGAGATGGCCGTGCTGGGGGAGGCCGGGGAGAGGCTGAAAGGGCCTCTACCTCAGGATTGAGCTTCAAGGATGAAGGAGACAATAAGCAGCC

TAAAAAAGAG GACCCTGAGAACCGAAACAAGATGCCAGT AGTTACTGAAGGCTCTCAGAATCATGGACATAATCCTCCCATGAAGTCTGAAGGGCTTC

GCCGATCAGCTAGTAAAATGTCTGTGCTCCAGAGCCAGCGAGTTGTGACTTCTACTCAGTCAAACCCTGAT GACATCCTGACACTGTCCAGCAGCACAG

AGAGTGAGGGGGAAAGTGGAACCAGCCGAAAGCCCACTGCTGGTCACACTTCAGCCACAGCTGTTGATAGTGATGACATCCAGACCATCTCTTCTGGCTC

TGACGGTGATGACTTTGAGGACAAGAAGAACTTGTCAG GACCAACAAAGCGCCAGGTGGCAGTAAAATCAACCCGAGGCTTTGCTCTTAAATCAACCCA

TGGTATTGCCATTAAATCAACCAACATGGCTTCCGTGGACAAGGGGGAGAGTGCACCAGTTCGTAAGAACACACGCCAGTTCTATGATGGTGAAGAGTCT

TGCTACATCATTGATGCCAAACTTGAAGGCAACCTAGGCCGCTACCTCAAT CACAGTTGCAGCCCCAACCTGTTTGTCCAGAATGTGTTTGTGGATACC

CATGATCTTCGCTTCCCTTGGGTGGCCTTCTTTGCCAGCAA - UNI5751 - - UNI30346 - GAGAATCCGGGCTGGAACAGAACTCACTTGGGA

CTACAACTACGAAGTGGGCAGTGTGGAAGGCAAGGAGCTGCTGTGCTGCTGTGGGGCCATTGAATGCAGAGGGAGACTTCTTTAGAGGAAGACTTCCTCA

CTTTGAGAACGCTTGAACTATCCTTTTCCCCAGGAACTGGGTCTTCCTGACTGTTGAACTCTGACCCCAAGTCTCTGATCTAGCTTCTTCCCAGCTCCTA

GTAGATAGAGATGGGGATTCTCAATCAGGACTTTCCCAGCGTGGTGCTAGCAGGCACTAGGGTGGGTAGACATGACCACTCTAGCATCAGCCTGAGGTCC

TTCTCATCTTGTATGCATTCATGATTCACATGGGCTGTGTATCTGCCATCCCTGATTTGTATGGTTTCTTGAAAGTCTTCTAACAAGATGGTAAAGTAGA

GATTGTGGTTTGTCTTATCTCCTGCCTTGATCTTCCATGTCATTTCCCAGTGGGCAACTATCATTAGTTTATACCTCGATTTTATTTGCCCTGTGTAATT

TTTAACTAAAAATGTTACATAACCACAAGGGAGGCCTAAGAAAAAAACTAACCCTTTCTCAAGTCTTAATAGTCTGACACAGTCATGTTTTATTTAACCT

TTAATATACTTTAATTAAAAAAAATTAACAGTA
Translation
 - UNI20719 - MSSLPGCMSLAAAPAAADSAEIAELQQAVVEELGISMEELRQYIDEELEKMDCIQQRKKQLAELETWVLQKESEVAYVDRLFDDAS

R REVTNCESLVKDFYSKLGLQYHDSSSEDEASRPTEIIEIPDEDDDVLSIDSG - UNI26429 - GDAGSRTPKDQK - UNI2280 - LREAMAA

LRKSAQDVQKFMDAVNKKSSSQDLHKG GTLGQVSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVG GLGKKYKVKFDNKGKSLLSGNHIAYDYH

PPADKLFVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLR RFLIFFDDGYASYVTQSELYPICRPL - UNI27883 - LKKTWEDIEDSSCRDFIEE

YITAYPNRPMVLLKSGQLIKTEWEGTWWKSRVEEVDGSLVRILFL - UNI14795 - - UNI19384 - DDKRCEWIYRGSTRLEPMFSMKTSSASA

MEKKQGGQLRTRPNMG - UNI14795 - GAVRSKGPVVQYTQDLTGTGIQFKPMEPLQPIAPPAPLPIPPLSPQAADTE - UNI14795 - - UNI

27498 - ESLESQLAQSRKQVAKKSTSFRPGSVGSGHSSPTSSTLSENVSAGKLGINQTYR RSPLASVTSTPASAAPPVPPVPPGPPTPPGPPAPPGP

LAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRIRPMRNEQYRGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYL

FETGCDFLFLEMFCLDPYVLVDRKFQPFKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFINTGPEFLVGCDCKDGCRDK - UNI2

1753 - KSKCACHQLTIQATACTPGGQVNPNSGYQYKRLEECLPTG GVYECNKRCNCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSF

VCIYAG GKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDVPTSSDSSGVDMKDQEDGNSGSEDPEESNDDSSDDNFCKDEDFSTSSVWRSYA

TRRQTRGQKENELSEMTSKDSRPPDLGPPHVPIPSSVSVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSRSSFKTSEGGDGRAGGGRGEAERAST

SGLSFKDEGDNKQPKKE DPENRNKMPV VVTEGSQNHGHNPPMKSEGLRRSASKMSVLQSQRVVTSTQSNPD DILTLSSSTESEGESGTSRKPTAGHT

SATAVDSDDIQTISSGSDGDDFEDKKNLSG GPTKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQFYDGEESCYIIDAKLEGNLGRY

LN HSCSPNLFVQNVFVDTHDLRFPWVAFFASK - UNI5751 - - UNI30346 - KRIRAGTELTWDYNYEVGSVEGKELLCCCGAIECRGRLL
Transcript ENSMUST00000107170
Sequence
CAAGGCGGAGCCCTGGAGTAAAACCTGGGGTCGGGGTTGTGAGACGCGGCCCTTGCGGTCGGGCGCCAGAGTTGTGGGGAGGACGGACTGAG - UNI20

719 - GGCCAAAGCATGTCCTCCCTCCCTGGGTGCATGAGTTTGGCTGCAGCGCCAGCTGCAGCTGACTCTGCAGAGATTGCTGAGCTGCAGCAGGCGG

TGGTTGAAGAGCTGGGTATCTCTATGGAGGAACTTCGTCAGTACATTGATGAGGAACTGGAAAAGATGGACTGCATACAGCAGCGCAAGAAGCAGCTCGC

AGAGCTGGAGACGTGGGTACTACAGAAAGAGTCTGAAGTGGCTTATGTTGATCGGCTGTTTGATGATGCATCCAG GGAAGTGACTAACTGTGAGTCTTT

GGTGAAGGATTTCTACTCTAAGCTGGGACTACAGTATCATGACAGTAGCTCTGAGGATGAAGCTTCCCGGCCCACAGAGATCATTGAGATTCCTGATGAA

GATGATGATGTCCTCAGTATTGATTCAG - UNI26429 - GTGATGCTGGGAGCAGAACTCCAAAAGACCAGAAG - UNI2280 - CTTCGTGAAG

CTATGGCTGCCTTAAGAAAATCAGCTCAAGATGTCCAGAAGTTCATGGATGCTGTCAACAAGAAAAGCAGTTCTCAAGATCTACATAAAG GAACCTTGG

GTCAGGTGTCTGGAGAACTGAGCAAAGATGGGGACCTGATAGTCAGCATGCGGATTCTGGGCAAGAAGAGGACTAAGACATGGCACAAAGGCACCCTTAT

TGCCATCCAGACTGTTG GGCTAGGAAAAAAATACAAAGTGAAATTTGACAACAAAGGAAAGAGTCTGCTATCTGGGAACCATATTGCCTATGATTACCA

CCCTCCCGCTGACAAGCTGTTTGTGGGCAGTCGAGTGGTGGCCAAGTACAAAGATGGAAATCAGGTCTGGCTTTATGCTGGCATTGTAGCTGAGACCCCT

AACGTCAAGAACAAGCTCAG ATTTTTAATTTTTTTTGATGATGGCTATGCTTCCTATGTCACTCAGTCAGAGCTTTATCCCATTTGCCGACCAC - UN

I27883 - TAAAAAAGACTTGGGAGGACATAGAAGATAGCTCCTGCCGAGACTTCATAGAGGAATATATCACTGCCTATCCAAACCGCCCAATGGTACT

TCTCAAGAGTGGGCAGCTTATCAAGACTGAGTGGGAAGGCACATGGTGGAAGTCTCGAGTTGAAGAGGTGGATGGCAGCCTAGTCAGGATCCTCTTTCTG

 - UNI14795 - - UNI19384 - GATGACAAAAGATGTGAGTGGATATATCGAGGCTCTACACGCCTGGAACCTATGTTTAGTATGAAGACATCCT

CAGCCTCTGCAATGGAGAAGAAGCAAGGGGGGCAACTCAGAACCCGTCCTAATATGG - UNI14795 - GTGCTGTGAGGAGCAAAGGTCCTGTTGTT

CAGTATACACAGGATCTAACTGGTACTGGAATCCAGTTTAAGCCCATGGAGCCCCTACAGCCTATAGCTCCACCGGCCCCACTTCCTATACCTCCTCTTT

CCCCCCAAGCAGCTGACACTGA - UNI14795 - - UNI27498 - CTTAGAAAGCCAACTTGCACAATCACGGAAACAAGTAGCCAAGAAGAGCAC

ATCATTCCGACCAGGATCTGTGGGCTCCGGCCATTCCTCCCCTACTTCATCCACACTCAGTGAAAATGTGTCTGCTGGGAAACTTGGGATAAACCAGACA

TATCG GTCACCTTTGGCCTCAGTAACATCTACCCCAGCATCTGCAGCCCCTCCAGTCCCTCCAGTCCCACCAGGGCCTCCAACCCCTCCAGGGCCTCCA

GCTCCTCCAGGGCCTCTAGCTCCTCCAGCCTTCCATGGCATGTTAGAGCGGGCACCAGCTGAGCCCTCCTACCGAGCCCCCATGGAGAAGCTTTTCTATT

TACCTCATGTCTGCAGTTACACTTGTTTGTCCCGGATCAGACCCATGAGAAACGAACAGTATCGGGGCAAGAACCCTCTATTAGTTCCACTTCTGTATGA

CTTCCGGAGGATGACAGCACGGCGCAGAGTTAACCGCAAAATGGGCTTTCATGTAATCTATAAGACACCCTGTGGTCTCTGCCTTCGGACGATGCAGGAG

ATAGAGCGCTACCTTTTTGAGACTGGCTGTGACTTTCTGTTCCTGGAGATGTTCTGTTTGGATCCATATGTTCTTGTTGACAGAAAGTTTCAACCCTTTA

AGCCTTTTTACTATATTTTGGACATCACCTATGGCAAGGAAGATGTTCCCCTGTCCTGTGTTAATGAGATTGACACAACTCCCCCACCCCAGGTGGCCTA

CAGCAAGGAACGCATTCCTGGCAAGGGTGTTTTCATTAACACAGGCCCTGAATTTCTGGTTGGCTGTGACTGCAAGGATGGGTGTCGGGATAA - UNI2

1753 - ATCCAAATGTGCCTGCCACCAGCTAACTATCCAGGCCACAGCCTGTACCCCAGGGGGCCAAGTCAACCCTAACTCTGGCTACCAGTATAAAAG

ACTAGAAGAGTGTCTGCCCACAGG GGTTTATGAGTGTAACAAACGCTGCAATTGTGACCCAAACATGTGCACAAATCGGTTGGTGCAGCATGGTCTGCA

GGTTCGACTACAGCTGTTTAAGACACAGAACAAGGGCTGGGGTATCCGCTGCTTGGATGATATTGCCAAAGGCTCTTTTGTCTGCATTTATGCAG GCAA

AATCCTGACAGATGACTTTGCAGACAAAGAAGGCCTGGAGATGGGTGATGAGTACTTTGCAAATCTGGACCACATTGAAAGTGTGGAGAACTTCAAGGAA

GGATATGAGAGTGATGTCCCCACTTCCTCTGACAGCAGTGGGGTAGATATGAAGGACCAGGAAGATGGCAACAGCGGTTCAGAGGACCCTGAAGAATCCA

ATGATGACAGCTCTGATGATAACTTCTGTAAGGATGAGGACTTCAGCACCAGTTCAGTGTGGCGTAGCTATGCTACCCGGAGGCAGACTCGGGGTCAAAA

GGAGAATGAATTGTCTGAGATGACTTCCAAGGACTCCCGCCCCCCAGACCTCGGGCCTCCACATGTTCCTATCCCTTCCTCAGTATCTGTAGGGGGCTGC

AATCCACCTTCCTCTGAAGAGACACCCAAGAACAAGGTGGCCTCGTGGTTGAGTTGCAATAGTGTCAGTGAAGGTGGATTTGCTGACTCTGACAGCCGTT

CTTCCTTCAAGACTAGTGAAGGTGGAGATGGCCGTGCTGGGGGAGGCCGGGGAGAGGCTGAAAGGGCCTCTACCTCAGGATTGAGCTTCAAGGATGAAGG

AGACAATAAGCAGCCTAAAAAAGAG GACCCTGAGAACCGAAACAAGATGCCAGT AGTTACTGAAGGCTCTCAGAATCATGGACATAATCCTCCCATGA

AGTCTGAAGGGCTTCGCCGATCAGCTAGTAAAATGTCTGTGCTCCAGAGCCAGCGAGTTGTGACTTCTACTCAGTCAAACCCTGAT GACATCCTGACAC

TGTCCAGCAGCACAGAGAGTGAGGGGGAAAGTGGAACCAGCCGAAAGCCCACTGCTGGTCACACTTCAGCCACAGCTGTTGATAGTGATGACATCCAGAC

CATCTCTTCTGGCTCTGACGGTGATGACTTTGAGGACAAGAAGAACTTGTCAG GACCAACAAAGCGCCAGGTGGCAGTAAAATCAACCCGAGGCTTTGC

TCTTAAATCAACCCATGGTATTGCCATTAAATCAACCAACATGGCTTCCGTGGACAAGGGGGAGAGTGCACCAGTTCGTAAGAACACACGCCAGTTCTAT

GATGGTGAAGAGTCTTGCTACATCATTGATGCCAAACTTGAAGGCAACCTAGGCCGCTACCTCAAT CACAGTTGCAGCCCCAACCTGTTTGTCCAGAAT

GTGTTTGTGGATACCCATGATCTTCGCTTCCCTTGGGTGGCCTTCTTTGCCAGCAA - UNI5751 - - UNI30346 - GAGAATCCGGGCTGGAAC

AGAACTCACTTGGGACTACAACTACGAAGTGGGCAGTGTGGAAGGCAAGGAGCTGCTGTGCTGCTGTGGGGCCATTGAATGCAGAGGGAGACTTCTTTAG

AGGAAGACTTCCTCACTTTGAGAACGCTTGAACTATCCTTTTCCCCAGGAACTGGGTCTTCCTGACTGTTGAACTCTGACCCCAAGTCTCTGATCTAGCT

TCTTCCCAGCTCCTAGTAGATAGAGATGGGGATTCTCAATCAGGACTTTCCCAGCGTGGTGCTAGCAGGCACTAGGGTGGGTAGACATGACCACTCTAGC

ATCAGCCTGAGGTCCTTCTCATCTTGTATGCATTCATGATTCACATGGGCTGTGTATCTGCCATCCCTGATTTGTATGGTTTCTTGAAAGTCTTCTAACA

AGATGGTAAAGTAGAGATTGTGGTTTGTCTTATCTCCTGCCTTGATCTTCCATGTCATTTCCCAGTGGGCAACTATCATTAGTTTATACCTCGATTTTAT

TTGCCCTGTGTAATTTTTAACTAAAAATGTTACATAACCACAAGGGAGGCCTAAGAAAAAAACTAACCCTTTCTCAAGTCTTAATAGTCTGACACAGTCA

TGTTTTATTTAACCTTTAATATACTTTAATTAAAAAAAATTAACAGTA
Translation
 - UNI20719 - MSSLPGCMSLAAAPAAADSAEIAELQQAVVEELGISMEELRQYIDEELEKMDCIQQRKKQLAELETWVLQKESEVAYVDRLFDDAS

R REVTNCESLVKDFYSKLGLQYHDSSSEDEASRPTEIIEIPDEDDDVLSIDSG - UNI26429 - GDAGSRTPKDQK - UNI2280 - LREAMAA

LRKSAQDVQKFMDAVNKKSSSQDLHKG GTLGQVSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVG GLGKKYKVKFDNKGKSLLSGNHIAYDYH

PPADKLFVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLR RFLIFFDDGYASYVTQSELYPICRPL - UNI27883 - LKKTWEDIEDSSCRDFIEE

YITAYPNRPMVLLKSGQLIKTEWEGTWWKSRVEEVDGSLVRILFL - UNI14795 - - UNI19384 - DDKRCEWIYRGSTRLEPMFSMKTSSASA

MEKKQGGQLRTRPNMG - UNI14795 - GAVRSKGPVVQYTQDLTGTGIQFKPMEPLQPIAPPAPLPIPPLSPQAADTD - UNI14795 - - UNI

27498 - DLESQLAQSRKQVAKKSTSFRPGSVGSGHSSPTSSTLSENVSAGKLGINQTYR RSPLASVTSTPASAAPPVPPVPPGPPTPPGPPAPPGPL

APPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRIRPMRNEQYRGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLF

ETGCDFLFLEMFCLDPYVLVDRKFQPFKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFINTGPEFLVGCDCKDGCRDK - UNI21

753 - KSKCACHQLTIQATACTPGGQVNPNSGYQYKRLEECLPTG GVYECNKRCNCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFV

CIYAG GKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDVPTSSDSSGVDMKDQEDGNSGSEDPEESNDDSSDDNFCKDEDFSTSSVWRSYAT

RRQTRGQKENELSEMTSKDSRPPDLGPPHVPIPSSVSVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSRSSFKTSEGGDGRAGGGRGEAERASTS

GLSFKDEGDNKQPKKE DPENRNKMPV VVTEGSQNHGHNPPMKSEGLRRSASKMSVLQSQRVVTSTQSNPD DILTLSSSTESEGESGTSRKPTAGHTS

ATAVDSDDIQTISSGSDGDDFEDKKNLSG GPTKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQFYDGEESCYIIDAKLEGNLGRYL

N HSCSPNLFVQNVFVDTHDLRFPWVAFFASK - UNI5751 - - UNI30346 - KRIRAGTELTWDYNYEVGSVEGKELLCCCGAIECRGRLL
Transcript ENSMUST00000107171
Sequence
AGTTTGCCTGGGTTTGGCAAGGCGGAGCCCTGGAGTAAAACCTGGGGTCGGGGTTGTGAGACGCGGCCCTTGCGGTCGGGCGCCAGAGTTGTGGGGAGGA

CGGACTGAG - UNI20719 - GGCCAAAGCATGTCCTCCCTCCCTGGGTGCATGAGTTTGGCTGCAGCGCCAGCTGCAGCTGACTCTGCAGAGATTGC

TGAGCTGCAGCAGGCGGTGGTTGAAGAGCTGGGTATCTCTATGGAGGAACTTCGTCAGTACATTGATGAGGAACTGGAAAAGATGGACTGCATACAGCAG

CGCAAGAAGCAGCTCGCAGAGCTGGAGACGTGGGTACTACAGAAAGAGTCTGAAGTGGCTTATGTTGATCGGCTGTTTGATGATGCATCCAG GGAAGTG

ACTAACTGTGAGTCTTTGGTGAAGGATTTCTACTCTAAGCTGGGACTACAGTATCATGACAGTAGCTCTGAGGATGAAGCTTCCCGGCCCACAGAGATCA

TTGAGATTCCTGATGAAGATGATGATGTCCTCAGTATTGATTCAG - UNI26429 - GTGATGCTGGGAGCAGAACTCCAAAAGACCAGAAG - UNI

2280 - CTTCGTGAAGCTATGGCTGCCTTAAGAAAATCAGCTCAAGATGTCCAGAAGTTCATGGATGCTGTCAACAAGAAAAGCAGTTCTCAAGATCTA

CATAAAG GAACCTTGGGTCAGGTGTCTGGAGAACTGAGCAAAGATGGGGACCTGATAGTCAGCATGCGGATTCTGGGCAAGAAGAGGACTAAGACATGG

CACAAAGGCACCCTTATTGCCATCCAGACTGTTG GGCTAGGAAAAAAATACAAAGTGAAATTTGACAACAAAGGAAAGAGTCTGCTATCTGGGAACCAT

ATTGCCTATGATTACCACCCTCCCGCTGACAAGCTGTTTGTGGGCAGTCGAGTGGTGGCCAAGTACAAAGATGGAAATCAGGTCTGGCTTTATGCTGGCA

TTGTAGCTGAGACCCCTAACGTCAAGAACAAGCTCAG ATTTTTAATTTTTTTTGATGATGGCTATGCTTCCTATGTCACTCAGTCAGAGCTTTATCCCA

TTTGCCGACCAC - UNI27883 - TAAAAAAGACTTGGGAGGACATAGAAGATAGCTCCTGCCGAGACTTCATAGAGGAATATATCACTGCCTATCCA

AACCGCCCAATGGTACTTCTCAAGAGTGGGCAGCTTATCAAGACTGAGTGGGAAGGCACATGGTGGAAGTCTCGAGTTGAAGAGGTGGATGGCAGCCTAG

TCAGGATCCTCTTTCTG - UNI14795 - - UNI19384 - GATGACAAAAGATGTGAGTGGATATATCGAGGCTCTACACGCCTGGAACCTATGTT

TAGTATGAAGACATCCTCAGCCTCTGCAATGGAGAAGAAGCAAGGGGGGCAACTCAGAACCCGTCCTAATATGG - UNI14795 - GTGCTGTGAGGA

GCAAAGGTCCTGTTGTTCAGTATACACAGGATCTAACTGGTACTGGAATCCAGTTTAAGCCCATGGAGCCCCTACAGCCTATAGCTCCACCGGCCCCACT

TCCTATACCTCCTCTTTCCCCCCAAGCAGCTGACACTGA - UNI14795 - - UNI27498 - AAGCTTAGAAAGCCAACTTGCACAATCACGGAAA

CAAGTAGCCAAGAAGAGCACATCATTCCGACCAGGATCTGTGGGCTCCGGCCATTCCTCCCCTACTTCATCCACACTCAGTGAAAATGTGTCTGCTGGGA

AACTTGGGATAAACCAGACATATCG GTCACCTTTGGCCTCAGTAACATCTACCCCAGCATCTGCAGCCCCTCCAGTCCCTCCAGTCCCACCAGGGCCTC

CAACCCCTCCAGGGCCTCCAGCTCCTCCAGGGCCTCTAGCTCCTCCAGCCTTCCATGGCATGTTAGAGCGGGCACCAGCTGAGCCCTCCTACCGAGCCCC

CATGGAGAAGCTTTTCTATTTACCTCATGTCTGCAGTTACACTTGTTTGTCCCGGATCAGACCCATGAGAAACGAACAGTATCGGGGCAAGAACCCTCTA

TTAGTTCCACTTCTGTATGACTTCCGGAGGATGACAGCACGGCGCAGAGTTAACCGCAAAATGGGCTTTCATGTAATCTATAAGACACCCTGTGGTCTCT

GCCTTCGGACGATGCAGGAGATAGAGCGCTACCTTTTTGAGACTGGCTGTGACTTTCTGTTCCTGGAGATGTTCTGTTTGGATCCATATGTTCTTGTTGA

CAGAAAGTTTCAACCCTTTAAGCCTTTTTACTATATTTTGGACATCACCTATGGCAAGGAAGATGTTCCCCTGTCCTGTGTTAATGAGATTGACACAACT

CCCCCACCCCAGGTGGCCTACAGCAAGGAACGCATTCCTGGCAAGGGTGTTTTCATTAACACAGGCCCTGAATTTCTGGTTGGCTGTGACTGCAAGGATG

GGTGTCGGGATAA - UNI21753 - ATCCAAATGTGCCTGCCACCAGCTAACTATCCAGGCCACAGCCTGTACCCCAGGGGGCCAAGTCAACCCTAAC

TCTGGCTACCAGTATAAAAGACTAGAAGAGTGTCTGCCCACAGG GGTTTATGAGTGTAACAAACGCTGCAATTGTGACCCAAACATGTGCACAAATCGG

TTGGTGCAGCATGGTCTGCAGGTTCGACTACAGCTGTTTAAGACACAGAACAAGGGCTGGGGTATCCGCTGCTTGGATGATATTGCCAAAGGCTCTTTTG

TCTGCATTTATGCAG GCAAAATCCTGACAGATGACTTTGCAGACAAAGAAGGCCTGGAGATGGGTGATGAGTACTTTGCAAATCTGGACCACATTGAAA

GTGTGGAGAACTTCAAGGAAGGATATGAGAGTGATGTCCCCACTTCCTCTGACAGCAGTGGGGTAGATATGAAGGACCAGGAAGATGGCAACAGCGGTTC

AGAGGACCCTGAAGAATCCAATGATGACAGCTCTGATGATAACTTCTGTAAGGATGAGGACTTCAGCACCAGTTCAGTGTGGCGTAGCTATGCTACCCGG

AGGCAGACTCGGGGTCAAAAGGAGAATGAATTGTCTGAGATGACTTCCAAGGACTCCCGCCCCCCAGACCTCGGGCCTCCACATGTTCCTATCCCTTCCT

CAGTATCTGTAGGGGGCTGCAATCCACCTTCCTCTGAAGAGACACCCAAGAACAAGGTGGCCTCGTGGTTGAGTTGCAATAGTGTCAGTGAAGGTGGATT

TGCTGACTCTGACAGCCGTTCTTCCTTCAAGACTAGTGAAGGTGGAGATGGCCGTGCTGGGGGAGGCCGGGGAGAGGCTGAAAGGGCCTCTACCTCAGGA

TTGAGCTTCAAGGATGAAGGAGACAATAAGCAGCCTAAAAAAGAG GACCCTGAGAACCGAAACAAGATGCCAGT AGTTACTGAAGGCTCTCAGAATCA

TGGACATAATCCTCCCATGAAGTCTGAAGGGCTTCGCCGATCAGCTAGTAAAATGTCTGTGCTCCAGAGCCAGCGAGTTGTGACTTCTACTCAGTCAAAC

CCTGAT GACATCCTGACACTGTCCAGCAGCACAGAGAGTGAGGGGGAAAGTGGAACCAGCCGAAAGCCCACTGCTGGTCACACTTCAGCCACAGCTGTT

GATAGTGATGACATCCAGACCATCTCTTCTGGCTCTGACGGTGATGACTTTGAGGACAAGAAGAACTTGTCAG GACCAACAAAGCGCCAGGTGGCAGTA

AAATCAACCCGAGGCTTTGCTCTTAAATCAACCCATGGTATTGCCATTAAATCAACCAACATGGCTTCCGTGGACAAGGGGGAGAGTGCACCAGTTCGTA

AGAACACACGCCAGTTCTATGATGGTGAAGAGTCTTGCTACATCATTGATGCCAAACTTGAAGGCAACCTAGGCCGCTACCTCAAT CACAGTTGCAGCC

CCAACCTGTTTGTCCAGAATGTGTTTGTGGATACCCATGATCTTCGCTTCCCTTGGGTGGCCTTCTTTGCCAGCAA - UNI5751 - - UNI30346 

- GAGAATCCGGGCTGGAACAGAACTCACTTGGGACTACAACTACGAAGTGGGCAGTGTGGAAGGCAAGGAGCTGCTGTGCTGCTGTGGGGCCATTGAAT

GCAGAGGGAGACTTCTTTAGAGGAAGACTTCCTCACTTTGAGAACGCTTGAACTATCCTTTTCCCCAGGAACTGGGTCTTCCTGACTGTTGAACTCTGAC

CCCAAGTCTCTGATCTAGCTTCTTCCCAGCTCCTAGTAGATAGAGATGGGGATTCTCAATCAGGACTTTCCCAGCGTGGTGCTAGCAGGCACTAGGGTGG

GTAGACATGACCACTCTAGCATCAGCCTGAGGTCCTTCTCATCTTGTATGCATTCATGATTCACATGGGCTGTGTATCTGCCATCCCTGATTTGTATGGT

TTCTTGAAAGTCTTCTAACAAGATGGTAAAGTAGAGATTGTGGTTTGTCTTATCTCCTGCCTTGATCTTCCATGTCATTTCCCAGTGGGCAACTATCATT

AGTTTATACCTCGATTTTATTTGCCCTGTGTAATTTTTAACTAAAAATGTTACATAACCACAAGGGAGGCCTAAGAAAAAAACTAACCCTTTCTCAAGTC

TTAATAGTCTGACACAGTCATGTTTTATTTAACCTTTAATATACTTTAATT
Translation
 - UNI20719 - MSSLPGCMSLAAAPAAADSAEIAELQQAVVEELGISMEELRQYIDEELEKMDCIQQRKKQLAELETWVLQKESEVAYVDRLFDDAS

R REVTNCESLVKDFYSKLGLQYHDSSSEDEASRPTEIIEIPDEDDDVLSIDSG - UNI26429 - GDAGSRTPKDQK - UNI2280 - LREAMAA

LRKSAQDVQKFMDAVNKKSSSQDLHKG GTLGQVSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVG GLGKKYKVKFDNKGKSLLSGNHIAYDYH

PPADKLFVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLR RFLIFFDDGYASYVTQSELYPICRPL - UNI27883 - LKKTWEDIEDSSCRDFIEE

YITAYPNRPMVLLKSGQLIKTEWEGTWWKSRVEEVDGSLVRILFL - UNI14795 - - UNI19384 - DDKRCEWIYRGSTRLEPMFSMKTSSASA

MEKKQGGQLRTRPNMG - UNI14795 - GAVRSKGPVVQYTQDLTGTGIQFKPMEPLQPIAPPAPLPIPPLSPQAADTE - UNI14795 - - UNI

27498 - ESLESQLAQSRKQVAKKSTSFRPGSVGSGHSSPTSSTLSENVSAGKLGINQTYR RSPLASVTSTPASAAPPVPPVPPGPPTPPGPPAPPGP

LAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRIRPMRNEQYRGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYL

FETGCDFLFLEMFCLDPYVLVDRKFQPFKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFINTGPEFLVGCDCKDGCRDK - UNI2

1753 - KSKCACHQLTIQATACTPGGQVNPNSGYQYKRLEECLPTG GVYECNKRCNCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSF

VCIYAG GKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDVPTSSDSSGVDMKDQEDGNSGSEDPEESNDDSSDDNFCKDEDFSTSSVWRSYA

TRRQTRGQKENELSEMTSKDSRPPDLGPPHVPIPSSVSVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSRSSFKTSEGGDGRAGGGRGEAERAST

SGLSFKDEGDNKQPKKE DPENRNKMPV VVTEGSQNHGHNPPMKSEGLRRSASKMSVLQSQRVVTSTQSNPD DILTLSSSTESEGESGTSRKPTAGHT

SATAVDSDDIQTISSGSDGDDFEDKKNLSG GPTKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQFYDGEESCYIIDAKLEGNLGRY

LN HSCSPNLFVQNVFVDTHDLRFPWVAFFASK - UNI5751 - - UNI30346 - KRIRAGTELTWDYNYEVGSVEGKELLCCCGAIECRGRLL

For any suggestions or comments, please send an email to unitrap@crg.es