Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000015711 (Prune)
Chromosomal location
Chr 3: 95057597 - 95085998 (-)
Description
prune homolog (Drosophila) Gene [Source:MGI (curated);Acc:Prune-001]
RefSeq_dna
NM_173347 
RefSeq_peptide
NP_775482.1 
UniGene
Mm.14155 
MGI
MGI:1925152 
Uniprot/SWISSPROT
Q8BIW1 
Human Ortholog
ENSG00000143363 (PRUNE)
Omim not available
UniTrap UNI4828
Vector Insertion
Chr 3: 95072246 - 95085506
Public Clones (sanger) AL0655 (sanger) RRM388 (baygenomics) RRM146 (baygenomics) P142D03 (ggtc)
D091G10 (ggtc) D068A04 (ggtc) E133C08 (ggtc) D086G12 (ggtc) 5SE047H07 (ggtc)
D096B07 (ggtc) CMHD-GT_337A9-3 (cmhd) CMHD-GT_387B2-3 (cmhd) CMHD-GT_517B12-3 (cmhd)
FHCRC-GT-S8-2C2 (fhcrc) FHCRC-GT-S1-8C1 (fhcrc) IST10358C6 (tigm) IST10259G8 (tigm)
IST13658C3 (tigm) IST12962B6 (tigm) IST13669C8 (tigm) IST10006D6 (tigm)
IST12053E6 (tigm) IST10956C5 (tigm) IST12251D11 (tigm) IST13886E9 (tigm)
IST12678D1 (tigm) IST14046F7 (tigm) IST12659F7 (tigm) IST10080E11 (tigm)
IST14252D6 (tigm) IST13243F7 (tigm) IST13248H8 (tigm) IST10438D8 (tigm)
IST13623H3 (tigm) IST14458F11 (tigm) IST14292D8 (tigm) IST12530H12 (tigm)
IST10118C6 (tigm) IST12765H3 (tigm) IST11027E1 (tigm) IST13181D7 (tigm)
IST12454H12 (tigm) IST14261F5 (tigm) IST10438C8 (tigm) IST14162B2 (tigm)
Private Clones OST461702 (lexicon) OST456077 (lexicon) OST447956 (lexicon) OST444235 (lexicon)
OST422957 (lexicon) OST401510 (lexicon) OST392805 (lexicon) OST389991 (lexicon)
OST388761 (lexicon) OST388401 (lexicon) OST385779 (lexicon) OST369825 (lexicon)
OST338887 (lexicon) OST335698 (lexicon) OST330199 (lexicon) OST309334 (lexicon)
OST289900 (lexicon) OST289288 (lexicon) OST286450 (lexicon) OST286179 (lexicon)
OST285428 (lexicon) OST285110 (lexicon) OST267890 (lexicon) OST261105 (lexicon)
OST260686 (lexicon) OST253315 (lexicon) OST251753 (lexicon) OST248875 (lexicon)
OST242635 (lexicon) OST237300 (lexicon) OST232394 (lexicon) OST214892 (lexicon)
OST208332 (lexicon) OST204251 (lexicon) OST192966 (lexicon) OST189682 (lexicon)
OST184204 (lexicon) OST179770 (lexicon) OST178820 (lexicon) OST169210 (lexicon)
OST168490 (lexicon) OST167913 (lexicon) OST153817 (lexicon) OST145323 (lexicon)
OST135277 (lexicon) OST132517 (lexicon) OST129761 (lexicon) OST129665 (lexicon)
OST128875 (lexicon) OST122825 (lexicon) OST118918 (lexicon) OST95885 (lexicon)
OST91477 (lexicon) OST87586 (lexicon) OST78146 (lexicon) OST77150 (lexicon)
OST59530 (lexicon) OST56926 (lexicon) OST54648 (lexicon) OST52871 (lexicon)
OST45523 (lexicon) OST37610 (lexicon) OST30767 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17566
Vector Insertion
Chr 3: 95069543 - 95072152
Public Clones CMHD-GT_505C7-3 (cmhd) CMHD-GT_487A7-3 (cmhd)
Private Clones OST440673 (lexicon) OST419738 (lexicon) OST394915 (lexicon) OST320368 (lexicon)
OST310524 (lexicon) OST308349 (lexicon) OST301268 (lexicon) OST296447 (lexicon)
OST289120 (lexicon) OST250218 (lexicon) OST196542 (lexicon) OST183044 (lexicon)
OST164948 (lexicon) OST47623 (lexicon) OST33071 (lexicon) OST26440 (lexicon)
OST7270 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17936
Vector Insertion
Chr 3: 95066292 - 95067513
Public Clones not available
Private Clones OST433197 (lexicon)
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4992
Vector Insertion
Chr 3: 95063257 - 95066132
Public Clones YTC384 (baygenomics) YTB036 (baygenomics) YTB009 (baygenomics) YTB026 (baygenomics)
PST2378-NR (escells) PST11851-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1008
Vector Insertion
Chr 3: 95062108 - 95063161
Public Clones AZ0088 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000015855
Sequence
ATTTACATCAATCTCGAACAGATTTTCGGTGTAATATATGGAAAGGTACTATACTTAGTCCTATCTGCAAGTTCAGATGCCATAAAGGCGAGTTATTGTG

ACACATACACAATTTGCATGTCATAGCCCTCCGAAAACTGCTCACTTGAGGACAAACACGAGCTGCTGGACTACATTTCCCAGGAGGCACCGCGATATAC

CATACTCCTCCTTGACGTCCCATGAGTCTTTGGGCTCAGAACCCAGCCTCTGCCGCTGGGGGGCGGGGCAACGCCGGACTCCCGGAGTGCCGGATTACGC

ACTTCCTCCTGGGGTTCGGAGGCCGAACCCTTTAGTGGCGGGTTCGAGTCCCGCCCCCTGACTCTCGGCTCTAGACCCTAGGTCTAGGGCGGGGTACATT

CTGCCGGGTTACCTCTCCTGGCTGAGGGGCAACGGCACACCTCGGGCTTTACCATGGAGGACTACCTGCAGGACTGTCGAGCCGCTTTGCAG - UNI48

28 - GATTCCAGGCCTCTACATGTCGTGCTGGGAAATGAAGCCTGCGACTTAGACTCCATGGTGTCTGCTCTCGCCTTGGCCTTCTACCTAACAAAG -

 UNI17566 - ACGTCTGAAGCTGAAGACATCTTTATACCAGTTTTAAATATAAAGCGTTCTGAGCTTCCTCTGCGCGGGGACAATGTCTTCTTTCTCC

AGGAGGTTAAGATTCCAGAGCCAGCCCTGATCTTCCGGGACGAGATTGACCTCCTAGCCCTGCACCAGGCTGGCCAGCTCACCCTCATCCTTGTTGACCA

CCATATTTTACCCAA AAGCGATGCAGCTCTGGAGGAGGCCGTAGCAGAGGTGCTGGACCACCGACCAATTGAGCAGAAATACTGTCCTCCCTGTCACGT

TTCAGTTGAGCTGGTGGGGTCCTGTGCCACCCTGGTGACAGAGAGAATCCTGCAGGGGGCACCAGAGACCTTGGACAGACAAACTGCAGCCCTACTGCAT

G - UNI17936 - GAACCATCATCCTGGACTGTGTCAACATGGATACCAACATTGGGAAGGCAACCCCAAAGGACAGCAAATATGTGGAAGAACTGGA

AGCCCTTTTCCCAGATCTGCCCAAAAGAAAGGACATATTTGATTCCCTGCAGAAGGCCAAGTTTGACGTCTCAG - UNI4992 - GACTGACCACTGA

ACAGATGCTCAGAAAGGACCAGAAGACAGTCTACAGACAGGGCACCAAGGTGGCAATCAGTGCAATCTACATGGACTTGAAG - UNI1008 - GCCTT

TCTGCAGCGGACAGACCTCTTCACAGATCTCAGTTCTTTCTGCCATGATCACAGCTATGATGCCCTGGTTGCCATGACTATCTTTTTCAACACTCAAAAT

GAGCCAGTACGGCAATTAGCTATCTTCTGTCCACACGAGGCACTTCGAATGACA ATCTGTGGCATCCTGGAACGATCCACCTCCCCACCCCTGAAGCTG

ACACCTATCCCAAGCACCTCCCCTAACCTCCAGGCCTATCACCAAGGCAACACCCAGGTCTCTCGGAAGAAGCTGCTGCCTGTGCTCCAGGAAGCCCTCT

CCGCATATCTTGACTCAGCGAAGATGGCTTCGGGGCAGTCTGAGGTAGCTGTGGGTATGTCTAGGGAGCAGGTGGACAAGGACTTGGACAAGGCAAGTAA

CTCCCTGATTTCTGGGCTGAGTCAAGATGAGGAAGACCCTCCGCTGCCACCCACGCCTATGAACAGCTTGGTGGATGAGTGCCCTCTGGATCAGGGGCTG

CCTAAGTTCTCCGCTGAGGCTGTCTTTGAGAAGTGCAGTCAGATCTCACTATCCCAGTCTGCCAGAGCCTGCACATCAAATAAGTGACCATTGGAAGTAG

GGTGGGGAAGTGTGGAGGAGGTGACTGGCCTGCCTCAAATGCATGTTTTGAGATGTTTGACCACTTCAGCAACTACGTCAGTGGCTTCAGGATCGGGTGT

ACTGTTCTCATAACCTTGGGAGGAGAAAGAGAAAGAGAGCGGCTGCTGTAGGGACAGCTCTCTGCCTCTCCTCTCCTGGCTCTACCAGTAAGACAAGATT

TATTTAATTTTATTATTTAATCTGCACTGATTTTCCTGTCTTTGGTGGGTACAGTGTGATAGGACCACTGTCCTGGCAGAGCAGGACTAAAGGAATGTAG

ACCCCATCTCAGTGTCTTCAGAAGGACTGTGAACAGAGGCAGCGTCTGCCATGAAACCAGTTCACCGCTCCTCTCCATGAATTGACCTTTTCAATTTTTT

TAAAGTTATTTTTGAGACAGAGCCTCATGTAGCCCAGGCTGGCCTTGAGCTCTGTATGTATCTGAGGCTAGTCCTGAATTCCTAACTCTCCTGAGTGCTG

AGATTGTCAAGCACTGCATTAAACCTGGCTGGTCTCTTGTCTTGACTTCCTATATCTTTGGCTCCTTCTGTCTCAGAATGATGGGAAGCCTGACGGGGAC

CTGAGGATTGAGGTCCTTGCTTTCTCCTGGTGGCCATGGGACCTCAGAGGCATTTTTGCCAAGAGGGCAGAACCTGACTGAGCCCTGGATATCCCCTGTC

TTAGTGGGTCTGCCAAGGTCTTGTCAGTCTTTTTCTGGTTTTGCTCAAGTTGAAGAATGCGTGGAGAGTCTTCTGGTGAGACATCCTCTGTCCCGGGTCC

CATTTCCCCACCTGTAACTGAGGTTAGGAAAAGATGTGCCCTTCCTTCCTCCCAGCCTTTCTCCCCTCTGCTTCCTCATTACTTTTGTCCTCCCTGGGAG

CGTTCGCGCTCTGGGTCACTGGATTGTTTCGTGTTTATGTGTGATTGTACCAAGGAACTTAGCCTCATGTAGCATGTACAGGGTTGTAATGGTGACCCAG

CAGCGAGCTCTCTCCCAGTAATTTGTTCCGCATGTGTAGTCTCCCCTCGCCTCCCCCACCTCCCATCCCCCTTTTTTCCAATCAAGCTGTTTCCCCTGTT

CTTACCCTATATAAGTTGCAAACAATATCGCTGAACAGTAGGGTGTGTGGTGGTTTGGGGCAGTCTGACTTCACTTTAGTGTATGACGTCTGTAGCCAAT

GGGAACGTGAAATATTGGTGCGATCACTGAACCAAAGGGATTGTGTTCTGTGACTTTGGTACTTTGTTTTGCATTTTTGTTTCATATTAAATACTTTCTT

TCTGTTTG
Translation
MEDYLQDCRAALQ - UNI4828 - DSRPLHVVLGNEACDLDSMVSALALAFYLTK - UNI17566 - TSEAEDIFIPVLNIKRSELPLRGDNVFFL

QEVKIPEPALIFRDEIDLLALHQAGQLTLILVDHHILPK KSDAALEEAVAEVLDHRPIEQKYCPPCHVSVELVGSCATLVTERILQGAPETLDRQTAAL

LHG - UNI17936 - GTIILDCVNMDTNIGKATPKDSKYVEELEALFPDLPKRKDIFDSLQKAKFDVSG - UNI4992 - GLTTEQMLRKDQKTVY

RQGTKVAISAIYMDLK - UNI1008 - AFLQRTDLFTDLSSFCHDHSYDALVAMTIFFNTQNEPVRQLAIFCPHEALRMT ICGILERSTSPPLKLTP

IPSTSPNLQAYHQGNTQVSRKKLLPVLQEALSAYLDSAKMASGQSEVAVGMSREQVDKDLDKASNSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPK

FSAEAVFEKCSQISLSQSARACTSNK

For any suggestions or comments, please send an email to unitrap@crg.es