Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000015748 (Prpf3)
Chromosomal location
Chr 3: 95634047 - 95659738 (-)
Description
PRP3 pre-mRNA processing factor 3 homolog (yeast) Gene [Source:MGI Symbol;Acc:MGI:1918017]
RefSeq_dna
NM_027541 
RefSeq_peptide
NP_081817.2 
UniGene
Mm.279872 
MGI
MGI:1918017 
Uniprot/SWISSPROT
Q922U1 
Uniprot/SPTREMBL
Q3UT19 
Human Ortholog
ENSG00000117360 (PRPF3)
Omim 601414 - RETINITIS PIGMENTOSA 18  
UniTrap UNI10936
Vector Insertion
Chr 3: 95657561 - 95659671
Public Clones (sanger) P022B10 (ggtc) D029C09 (ggtc) PST5568-NL (escells) PST4004-NR (escells)
IST10031F8 (tigm)
Private Clones OST412775 (lexicon) OST293703 (lexicon) OST240209 (lexicon) OST108342 (lexicon)
OST73891 (lexicon) OST66924 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8515
Vector Insertion
Chr 3: 95655617 - 95657366
Public Clones RRO284 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6628
Vector Insertion
Chr 3: 95639667 - 95640336
Public Clones YHB037 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3744
Vector Insertion
Chr 3: 95634889 - 95636483
Public Clones XS0347 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000015892
Sequence
GGCAACCGGAAGGTTTCCGGTTCCGGTGTAACGTTCGGGCTCCGTCTCAGGGGCTGAAGTTTGTGAG - UNI10936 - GTGTAGTTTTTTTGTCCCA

TTGGAGCTCTCATTCTCCATTTTCTCCGAAATGGCGCTGTCTAAGCGGGAGCTGGATGAGCTGAAGCCATGGATAGAGAAGACGGTGAAGAGAGTGCTGG

GCTTCTCAGAGCCCACAGTGGTCACTGCAGCCTTGAACTGTGTGGGGAAGGGCATGGACAAAAAGAAGGCGGCTG - UNI8515 - ATCACCTGAAAC

CTTTTCTTGATGATTCCACTCTCCGATTTGTGGATAAGCTGTTTGAGGCTGTGGAGGAAGGCCGAAGCTCAAGGCATTCCAAGTCTAGCAGTGACAGAAG

CAGAAAGCGAGAGTTAAAG GAGGTGTTTGGTGATGACTCTGAGATCTCAAAGGAATCATCGGGGGTAAAGAAGCGGCGGATACCCCGTTTTGAGGAGGT

AGAAGAGGAGCCAGAGGTGATCCCTGGACCTCCATCAGAAAGCCCTGGCATGCTAACAAAGCTCCAG ATCAAACAGATGATGGAAGCAGCAACACGACA

AATCGAGGAACGGAAAAAACAGCTGAGCTTCATCAGCCCCCCTGCACCTCAG CCAAAGACACCTTCTTCTTCCCAACCAGAGCGACTTCCCATCGGCAA

CACTATTCAGCCCTCCCAGGCCGCTACCTTTATGAACGATGCCATTGAGAAGGCGAGGAAAGCTGCCGAGCTGCAAGCCCGAATCCAGGCCCAGCTGGCG

TTGAAGCCAGGGCTTATTGGCAATGCCAACATGGTGGGCCTAGCTAATCTCCATGCCATGGGCATAGCTCCACC GAAAGTAGAGTTAAAAGACCAAACT

AAGCCTACCCCATTGATCCTGGACGAGCAAGGCCGCACTGTGGATGCGACAGGCAAGGAGGTGGAGCTCACACATCGCATGCCCACCCTGAAGGCAAACA

TTCGGGCTGTGAAGAGGGAACAGTTCAAGCAGCAGCTAAAAGAAAAGCCATCAGAAGACATGGAGTCTAATACCTTTTTTGACCCCCGAGTCTCAATTGC

CCCTTCCCAGCGCCAAAGACGCACTTTTAAATTCCATGACAAGGGCAAATTTGAGAAAATTGCTCAACGATTACGGACAAAG GCTCAATTGGAGAAGCT

GCAAGCAGAGATTTCACAAGCTGCTAGAAAAACAGGCATTCATACTTCGACTAGACTTGCCCTCATTGCTCCCAAAAAGGAGCTAAAGGAAGGCGATATC

CCTGAGATTGAGTGGTGGGACTCGTACATCATACCCAACGGCTTTGACCT TACAGAGGAAAATCCCAAGAGAGAAGATTATTTTGGAATCACAAATCTT

GTTGAACATCCAGCCCAGCTTAATCCTCCAG TTGACAATGATACACCAGTTACCCTTGGGGTATATCTTACGAAGAAGGAGCAGAAGAAACTACGGAGG

CAAACAAGAAGGGAAGCACAGAAAGAGCTACAAGAGAAAGTCAGGCTAGGCCTGACACCTCCTCCAGAGCCCAAAG - UNI6628 - TGAGAATCTCA

AATTTAATGCGAGTATTAGGAACAGAAGCAGTTCAAGACCCTACAAAGGTAGAAGCCCATGTCAGAGCTCAGATGGCAAAGAGACAGAA AGCGCATGAA

GAGGCCAACGCGGCCCGAAAACTTACAGCAGAACAGAGAAAGGTCAAGAAAATTAAAAAGCTTAAAGAAGACATTTCACAGGGGGTGCACATATCTGTGT

ATAG AGTTCGAAATTTGAGCAACCCAGCCAAGAAGTTCAAGATTGAGGCCAATGCTGGGCAGCTGTACCTGACAGGGGTGGTGGTGCTGCACAAAGATG

TCAACGTGGTGGTAGTGGAAGGGG GCCCCAAAGCCCAGAAGAAATTTAAGCGTCTCATGCTACATCGGATAAAGTGGGATGAGCAGACATCTAACACGA

AGGGAGATG ATGATGAGGAATCTGATGAAGAAGCTGTGAAGAAAACTAACAAATGTGTACTAGTATGGGAG - UNI3744 - GGTACAGCCAAAGAC

CGGAGCTTTGGAGAGATGAAGTTTAAACAGTGCCCTACAGAGAACATGGCTCGTGAGCATTTCAAAAAGCATGGGGCTGAACACTACTGGGACCTTGCAC

TGAGTGAATCTGTGTTGGAGTCCACCGACTGAGACTACTGTTAGCCCTTGTATCTTCTTTGCCTTTGTTTCTTCTGTCTTCTCACTCTACTTCCCAACCT

TACCCCACCGTGCGTGTGATCTCAGAACTGTGCCAGGCCGATACCAGGGCAAAAAGACTACCAAGTTCACCCAGTCAGCCTGGTGCTACCCTCCATCCTG

TATGTGCATATGATTAAAGAGTTATTTTTAAAATTAGTATGATATTTTTCATATGGTCATAGATATTAGAATTTGGTTTTGTGGGTGATTTTTCCATATT

CCTAGGATCCTAGTAGTTTAAGTGTGTAAATGTCTGACTTCTAAGCAAATGGTAAGTACAGTTTTCTGGAGATAGTAAGTCAGAAAGTAGTGTTAAGTGG

TTGTGGGATGAGTGGCCAAATGCAGTATGTATTTCTTAACCTTTATAGCTAGAATAATAAGGTCATATGTTGTTGGTTTCTTTAGGTCAAGTCCTAGGAA

ATTAGTTCTTCAAATGGGTATGGCTATTTTGATTGAAATAGACTACATACTATCCAAGGGCATCAGTTTGTAAACTAAGACAGGAATCAGTAATGTAGTT

CAATTTCCACTGTTAATGATGCCATGTGACTCCTCTCAGCGATATGCTGAATAACCTTTTAAGAAGATTTAAGATAGGCTGTCATGGCCGGGCGTGGTGG

CGCACGCCTTTAATCCCAGCACTCAGG
Translation
 - UNI10936 - MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAAD - UNI8515 - DHLKPFLDDSTLRFVDKLFEAVEE

GRSSRHSKSSSDRSRKRELK EVFGDDSEISKESSGVKKRRIPRFEEVEEEPEVIPGPPSESPGMLTKLQ IKQMMEAATRQIEERKKQLSFISPPAPQ 

PKTPSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGIAPP PKVELKDQTKPTPLILDEQGRTVDA

TGKEVELTHRMPTLKANIRAVKREQFKQQLKEKPSEDMESNTFFDPRVSIAPSQRQRRTFKFHDKGKFEKIAQRLRTK AQLEKLQAEISQAARKTGIHT

STRLALIAPKKELKEGDIPEIEWWDSYIIPNGFDL LTEENPKREDYFGITNLVEHPAQLNPPV VDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQE

KVRLGLTPPPEPKV - UNI6628 - VRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQK KAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVY

R RVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGG GPKAQKKFKRLMLHRIKWDEQTSNTKGDD DDEESDEEAVKKTNKCVLVWE - UN

I3744 - GTAKDRSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLESTD

For any suggestions or comments, please send an email to unitrap@crg.es