Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000015850 (Adamtsl4)
Chromosomal location
Chr 3: 95480124 - 95491840 (-)
Description
ADAMTS-like 4 Gene [Source:MGI (curated);Acc:Adamtsl4-001]
RefSeq_dna
NM_144899 
RefSeq_peptide
NP_659148.2 
UniGene
Mm.475756 
MGI
MGI:2389008 
Uniprot/SWISSPROT
Q80T21 
Uniprot/SPTREMBL
Q91YP4 
Human Ortholog
ENSG00000143382 (ADAMTSL4)
Omim not available
UniTrap UNI25134
Vector Insertion
Chr 3: 95489595 - 95491743
Public Clones not available
Private Clones OST194221 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33224
Vector Insertion
Chr 3: 95486132 - 95487334
Public Clones IST12138B2 (tigm) IST13058E6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31132
Vector Insertion
Chr 3: 95485574 - 95486270
Public Clones IST13764F7 (tigm) IST13896A9 (tigm) IST10346B11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33205
Vector Insertion
Chr 3: 95485182 - 95485780
Public Clones IST14185D6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32246
Vector Insertion
Chr 3: 95484659 - 95485059
Public Clones IST10255H12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32265
Vector Insertion
Chr 3: 95484367 - 95484846
Public Clones IST10255H12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34564
Vector Insertion
Chr 3: 95483510 - 95484119
Public Clones IST14828A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31759
Vector Insertion
Chr 3: 95481730 - 95483688
Public Clones (sanger) CMHD-GT_535H3-3 (cmhd) CMHD-GT_535H3-5S (cmhd) IST11067H6 (tigm)
IST10591E2 (tigm) IST13960D5 (tigm) IST13514G12 (tigm) IST14420A11 (tigm)
IST12782B1 (tigm) IST14753G6 (tigm) IST10299A1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29109
Vector Insertion
Chr 3: 95481631 - 95481730
Public Clones IST13149F2 (tigm) IST11547D8 (tigm)
Private Clones OST8613 (lexicon)
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31232
Vector Insertion
Chr 3: 95481033 - 95481631
Public Clones IST13799F3 (tigm) IST12145F5 (tigm) IST14267F7 (tigm) IST14648E5 (tigm)
IST11706B1 (tigm) IST14157D9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26002
Vector Insertion
Chr 3: 95480893 - 95481033
Public Clones IST12368C7 (tigm) IST14305H7 (tigm)
Private Clones OST147525 (lexicon)
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34497
Vector Insertion
Chr 3: 95480123 - 95480893
Public Clones IST14371D8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000015994
Sequence
ACTACCAGAGGCAGCTGGAGAGAGCGGGCGCAGAGAAG - UNI25134 - AGCACCCTCCAAGCCCCGATGCCAGAGTAGCCACCCTGTCCCCTGCTC

CCCAGCCCAGGGGCAGTCACAGGAAGAGCAATGGAATCTTGGCTGGGCAG GCTCTGGCTGTGTATGATGCTGCTCCTGCCTCTCCCTCAGCCCTGCCAG

GATCAGGAG CTGTTTGGACCTTCTCATCAGCTGCCATCAGAGGAGGGCCAGGTCCCTGAAGGCCTCTGGGGACCTTGGGGTCGATGGGCTTCCTGCTCC

CAGCCCTGTGGGGTGGGGGTGCAGCGCAGGAGCCGAACATGTGAACTGCACCCAGCCCTACCCCTCCCTCCCCGACCCCCAAGACATCCAGAAGCCCACC

GGCCCCGGGGCCAGGGCTCCAGACCCCAGACTCCACGGGATCCCCAGTCTCTGTATAGGCCACAGCCTCGGGGAAGGGGTGGCCCTCTTCGAGCTCCTGC

TTCTCAAGTGGGGAGAGAGGAAACCCAGGAGCCTCAAGGGGCCCAGAG GTTCCGGGTTCGAGACCCCATCAAGCCAGGGATGTTCGGTTATGGGAGAGT

GCCTTTTGCCTTGCCTCTGCACCGGAGCCGCAGGCATCCTCACAGACCCGGGCAACCCAAGAACTCTTCTACAGGGGAAGGGATGGTTCCATCTCAGCCT

CCAAGCACAGAGCTGGCCTCTGAAAAGCACGGCCCTCACATGCAGCCCCCTGAACCCCGTTCTCACTCAGCTGAAACTCCAAGGTCTGGAACTGCTCAGA

CAGAAGTGCTCCCCAGAACTAGTTCTGCTCCTTCCTACACAGGGACCCCTGCACCTACCTCCTCTTTTGGAGACAGTAGGTCTTTCCAGGGATCCCTTGG

GCCACGAATGCCACCTTCCCCGGGAAGTTGGAGCAGTCCCCAGGGAGCAGAGCGACGACACCCACCTCCTTTCTCTCCTGTCCCCCGGAGCCAGCAGAGC

AGGAGGCACTGGAGACCTCCAGGTCCTCACAGGTCCCCAGATGGCTGGCTGCCCCTGACAAGAGACTCCAGCCCACTCTGGAGCATCTTTGCTCCCAGTA

TCCCTGCTCCAAACTGTTCTGGGGAAAGTGAACAGATGCGAGCCTGCAGCCAGGAG - UNI33224 - CCTTGCCCCCCTGAGCAGCCAGACCCCAGG

GCCCTACAGTGTGCCGCCTTTGACTCCCAGGAATTCATGGGCCAGCTGTACCAGTGGGAGCCCTTCACCGAAG - UNI31132 - - UNI33224 - 

TTCAGGGCTCCCAGCGCTGTGAACTGAACTGCCGCCCCCGTGGCTTCCGATTCTATGTCCGACACACTGAAAAGGTGCAGGATGGAACCCTGTGTCAGCC

TGGATCCCTAGACATCTGTGTGGCTGGACGCTGCCTG - UNI31132 - - UNI33205 - - UNI33224 - AGCCCTGGCTGTGATGGGGTCCT

TGGCTCTGGCAGGCGTCCGGATGGCTGCGGAGTCTGCGGGGGTGATGGTTCTACCTGCCGCCTGGTTTCGGGAAATCTCACTGACCGAGGGGGCCCCTTG

GGCTATCAGAAGATCCTGTGGATCCCTGCCGGGGCCTCCCACCTTCACATTTCCCAGTTGCGACCCAGTTCCAATTACCTCG - UNI31132 - - UN

I33205 - CACTCCGAGGGCCTGGGGGCCGCTCCATTATCAATGGGAACTGGGCTGTGGATCCTCCAGGGTCCTATACAGCCATTGGGACTGTCTTCCA

GTATAACCGTCCTCCACGGGAAGAAGGCAAGGGGGAGAGTCTGTCAGCAGAAGGCCCTACCACTCAGCCTGTGGACGTCTAT - UNI32246 - - UN

I33205 - ATGATCTTTCAAGAGGACAACCCAGGTGTTTTTTATCAGTATGTCATCTCTTCCCCTCCTGCAGTCCTAGAGAGTCCTTCCACAAAGCCTC

CAGCCCTTCAGCCTCAGCCTG - UNI32246 - - UNI32265 - AGATGCTGAGGGGGGAGCCCCTACTCCCCTCAGCCCCCCGCCCAGTCCGGGC

ACCAGGCACCCTCCAACGTCAGGTGCGGATTCCCCAAGTGCCTCCTCCGACTCGTGTCAGGACAGCCATGGGGTCTTCTGCTGGATACTGGAAACAAGTG

GGGCACTCTGAGTGTTCAGCATCCTGTGGCAAAG - UNI32246 - - UNI32265 - GTGTTTGGCACCCCATTTTCCTCTGCATTTCCCGTGAGT

CAGGAGAGGAGTTGGATGAACAGAGCTGTGCTGTGGGGGCCAGACCCCCAGCTTCCCCTGAACCCTGCCATGGACCCCCGTGTCCTCCATA - UNI322

65 - - UNI34564 - CTGGGAGGCTGGCGAGTGGACATCCTGCAGCCGATCCTGTGGCCCTGGCACCCAGCACCGCCAGCTACTCTGCAGACAGGAA

TTCGGAGGTGGTGGCTCCTCGGTACCTCCAGAGCGCTGTGGACATCTCCCCCGGCCCAACATCACCCAGCCTTGTCAGCTGCACCTCTGTGGCCACTGGG

AGATTAGCTCCCCCTGGAGCCAG - UNI31759 - - UNI34564 - TGCTCTGTGCGCTGTGGTCGTGGTCAGAGGAGCCGGCAAGTTCGGTGTGT

TGGCAGTAATGGTGATGAGGTGGACAAGCAGGAGTGTGCTTCAGGGCCCCCGCCGCCCCCCAGCAGAGAGGCCTGTGACATGGGCCCCTGCACCACAGCC

TGGTTCTACAGTGACTGGAGTTCCAAG - UNI31759 - - UNI34564 - TGCTCAGCCGAGTGCGGGACAGGAATCCAGAGACGCGCTGTGGTCT

GCCTTAGGAGTGGGGAGACCCTTCAGGGAGACCCGGAAGCAGGAAGCACTGAGCAGGGCTGCCCTCTCAGAAGCCGCCCTCCCGATATGCGTGCCTGCAG

TTTAGGGCCCTGTGAGAGGACATGGCGCTGGTTCACAGGCCCCTGGAGTGAG - UNI29109 - - UNI31232 - - UNI31759 - TGTTCCTC

GGAGTGTGGGTCTGGCACACAACACAGAGACATTATCTGTGTGTCCAAGCTGGGGGCCGAGTTCAATGTGACTTCTCCCAGCAACTGTTCCCACCTACCC

AGGCCGCCTGCCCTGCAGCCCTGTCAGGGGCAGGCCTGTGAGGACAAATGGTTCTCCACTCTCTGGAGTCCG - UNI31232 - TGTTCTCGATCCTG

CCAGGGAGGCATGCAGACGAGGGAAGTCCAGTGCCTGAGTGGCAACCAGACTCTCAGCTCCCGATGCCCTCCTCACCTGAGACCTTCCAGGAAGCGGCCC

TGCAACAGCCAACCCTGCAACCAGCGACCAG - UNI26002 - - UNI31232 - - UNI34497 - ATGACCAATGCAAGGACAGCTCTCCACAC

TGCCCCCTGGTGGTACAGGCCCGGCTCTGCGTCTACCCCTACTACACAACTACCTGCTGCCGCTCTTGTGCCCATGTCCTGGAGCAGTCCCAGCTGGAAC

CGGCTTGAAACGGGTCCCAGAGACCCTGCCTTCGTGGTTTTCTTGTGCCACCCACTGACTAGCCCGCTCTGTACCCTCTGGCTTTTCACCTGGTCTCAGC

CTTGCCAGAGGGATCCTCCAGGGTGAGAGACCTACAGTGTGATAGCTCAAGAAGTGTACCTGACCTGCCTGGGGGTCTGTCCTGTGTATGTTTATCACTT

CCACAAAAGCAGCTTGAGAAAGAATAGGAAGTGGGCGGTGCCTGTATCCCTCATGCTTTTCTGGGCTGGGGAGAAAGGGGGAGAGAGCAAGGTTATATTT

CCACACTAATCTGAGCTACATAGTGTGTGTCCCCCAGAAGTTCCAGGTCTGTGCCCCAATCCTCGTCTCCACATCTTCTAAATTACCCTGTTGTTCCCAT

CCCTGCCTTATCTAGTCTCTGTATTCCTACCTCCCTCATTAGCAGGGGCAGGGATCAGCCACTGCTACCCTACCTTACTGGGGAAGGACCACACCTCTCC

AGGGCAGGGACCACTTGTGTCGAGGGTGAAAAAGAGAAACGTCAGCATAAGACATCCTAGCCCCAGTCGCCACTTCACACTGAAAATGATGCCCACCCCA

GAAGTAATTTATTTTTTATTAAAGTTGGTTTTGACAT
Translation
 - UNI25134 - MESWLGR RLWLCMMLLLPLPQPCQDQE LFGPSHQLPSEEGQVPEGLWGPWGRWASCSQPCGVGVQRRSRTCELHPALPLPPRPP

RHPEAHRPRGQGSRPQTPRDPQSLYRPQPRGRGGPLRAPASQVGREETQEPQGAQR RFRVRDPIKPGMFGYGRVPFALPLHRSRRHPHRPGQPKNSSTG

EGMVPSQPPSTELASEKHGPHMQPPEPRSHSAETPRSGTAQTEVLPRTSSAPSYTGTPAPTSSFGDSRSFQGSLGPRMPPSPGSWSSPQGAERRHPPPFS

PVPRSQQSRRHWRPPGPHRSPDGWLPLTRDSSPLWSIFAPSIPAPNCSGESEQMRACSQE - UNI33224 - PCPPEQPDPRALQCAAFDSQEFMGQL

YQWEPFTEV - UNI31132 - - UNI33224 - VQGSQRCELNCRPRGFRFYVRHTEKVQDGTLCQPGSLDICVAGRCL - UNI31132 - - UN

I33205 - - UNI33224 - SPGCDGVLGSGRRPDGCGVCGGDGSTCRLVSGNLTDRGGPLGYQKILWIPAGASHLHISQLRPSSNYLA - UNI311

32 - - UNI33205 - ALRGPGGRSIINGNWAVDPPGSYTAIGTVFQYNRPPREEGKGESLSAEGPTTQPVDVY - UNI32246 - - UNI33205

 - MIFQEDNPGVFYQYVISSPPAVLESPSTKPPALQPQPE - UNI32246 - - UNI32265 - EMLRGEPLLPSAPRPVRAPGTLQRQVRIPQVP

PPTRVRTAMGSSAGYWKQVGHSECSASCGKG - UNI32246 - - UNI32265 - GVWHPIFLCISRESGEELDEQSCAVGARPPASPEPCHGPPCP

PY - UNI32265 - - UNI34564 - YWEAGEWTSCSRSCGPGTQHRQLLCRQEFGGGGSSVPPERCGHLPRPNITQPCQLHLCGHWEISSPWSQ -

 UNI31759 - - UNI34564 - CSVRCGRGQRSRQVRCVGSNGDEVDKQECASGPPPPPSREACDMGPCTTAWFYSDWSSK - UNI31759 - - 

UNI34564 - CSAECGTGIQRRAVVCLRSGETLQGDPEAGSTEQGCPLRSRPPDMRACSLGPCERTWRWFTGPWSE - UNI29109 - - UNI3123

2 - - UNI31759 - CSSECGSGTQHRDIICVSKLGAEFNVTSPSNCSHLPRPPALQPCQGQACEDKWFSTLWSP - UNI31232 - CSRSCQGGM

QTREVQCLSGNQTLSSRCPPHLRPSRKRPCNSQPCNQRPD - UNI26002 - - UNI31232 - - UNI34497 - DDQCKDSSPHCPLVVQARLC

VYPYYTTTCCRSCAHVLEQSQLEPA
Transcript ENSMUST00000117782
Sequence
GGCGTGGGGCGGAGCCTGCCGCGGGCGGCGCTGTCCTGGGGCTCCGGGCCGCGGTGGCCACTACCAGAGGCAGCTGGAGAGAGCGGGCGCAGAGAAG - 

UNI25134 - GTCCTAAAGGGGTGGACCATTCCTCCCCCACCCCTCCAGGCTGTTGGTGTTGTGCTGAGACAGCCCTTCAGTCCCCCCAGATAGCTGGA

GGGGTAACGCCATGCTCCTCCCTCCTCAGAGCACCCTCCAAGCCCCGATGCCAGAGTAGCCACCCTGTCCCCTGCTCCCCAGCCCAGGGGCAGTCACAGG

AAGAGCAATGGAATCTTGGCTGGGCAG GCTCTGGCTGTGTATGATGCTGCTCCTGCCTCTCCCTCAGCCCTGCCAGGATCAGGAG CTGTTTGGACCTT

CTCATCAGCTGCCATCAGAGGAGGGCCAGGTCCCTGAAGGCCTCTGGGGACCTTGGGGTCGATGGGCTTCCTGCTCCCAGCCCTGTGGGGTGGGGGTGCA

GCGCAGGAGCCGAACATGTGAACTGCACCCAGCCCTACCCCTCCCTCCCCGACCCCCAAGACATCCAGAAGCCCACCGGCCCCGGGGCCAGGGCTCCAGA

CCCCAGACTCCACGGGATCCCCAGTCTCTGTATAGGCCACAGCCTCGGGGAAGGGGTGGCCCTCTTCGAGCTCCTGCTTCTCAAGTGGGGAGAGAGGAAA

CCCAGGAGCCTCAAGGGGCCCAGAG GTTCCGGGTTCGAGACCCCATCAAGCCAGGGATGTTCGGTTATGGGAGAGTGCCTTTTGCCTTGCCTCTGCACC

GGAGCCGCAGGCATCCTCACAGACCCGGGCAACCCAAGAACTCTTCTACAGGGGAAGGGATGGTTCCATCTCAGCCTCCAAGCACAGAGCTGGCCTCTGA

AAAGCACGGCCCTCACATGCAGCCCCCTGAACCCCGTTCTCACTCAGCTGAAACTCCAAGGTCTGGAACTGCTCAGACAGAAGTGCTCCCCAGAACTAGT

TCTGCTCCTTCCTACACAGGGACCCCTGCACCTACCTCCTCTTTTGGAGACAGTAGGTCTTTCCAGGGATCCCTTGGGCCACGAATGCCACCTTCCCCGG

GAAGTTGGAGCAGTCCCCAGGGAGCAGAGCGACGACACCCACCTCCTTTCTCTCCTGTCCCCCGGAGCCAGCAGAGCAGGAGGCACTGGAGACCTCCAGG

TCCTCACAGGTCCCCAGATGGCTGGCTGCCCCTGACAAGAGACTCCAGCCCACTCTGGAGCATCTTTGCTCCCAGTATCCCTGCTCCAAACTGTTCTGGG

GAAAGTGAACAGATGCGAGCCTGCAGCCAGGAG - UNI33224 - CCTTGCCCCCCTGAGCAGCCAGACCCCAGGGCCCTACAGTGTGCCGCCTTTGA

CTCCCAGGAATTCATGGGCCAGCTGTACCAGTGGGAGCCCTTCACCGAAG - UNI31132 - - UNI33224 - TTCAGGGCTCCCAGCGCTGTGAA

CTGAACTGCCGCCCCCGTGGCTTCCGATTCTATGTCCGACACACTGAAAAGGTGCAGGATGGAACCCTGTGTCAGCCTGGATCCCTAGACATCTGTGTGG

CTGGACGCTGCCTG - UNI31132 - - UNI33205 - - UNI33224 - AGCCCTGGCTGTGATGGGGTCCTTGGCTCTGGCAGGCGTCCGGATG

GCTGCGGAGTCTGCGGGGGTGATGGTTCTACCTGCCGCCTGGTTTCGGGAAATCTCACTGACCGAGGGGGCCCCTTGGGCTATCAGAAGATCCTGTGGAT

CCCTGCCGGGGCCTCCCACCTTCACATTTCCCAGTTGCGACCCAGTTCCAATTACCTCG - UNI31132 - - UNI33205 - CACTCCGAGGGCCT

GGGGGCCGCTCCATTATCAATGGGAACTGGGCTGTGGATCCTCCAGGGTCCTATACAGCCATTGGGACTGTCTTCCAGTATAACCGTCCTCCACGGGAAG

AAGGCAAGGGGGAGAGTCTGTCAGCAGAAGGCCCTACCACTCAGCCTGTGGACGTCTAT - UNI32246 - - UNI33205 - ATGATCTTTCAAGA

GGACAACCCAGGTGTTTTTTATCAGTATGTCATCTCTTCCCCTCCTGCAGTCCTAGAGAGTCCTTCCACAAAGCCTCCAGCCCTTCAGCCTCAGCCTG -

 UNI32246 - - UNI32265 - AGATGCTGAGGGGGGAGCCCCTACTCCCCTCAGCCCCCCGCCCAGTCCGGGCACCAGGCACCCTCCAACGTCAGG

TGCGGATTCCCCAAGTGCCTCCTCCGACTCGTGTCAGGACAGCCATGGGGTCTTCTGCTGGATACTGGAAACAAGTGGGGCACTCTGAGTGTTCAGCATC

CTGTGGCAAAG - UNI32246 - - UNI32265 - GTGTTTGGCACCCCATTTTCCTCTGCATTTCCCGTGAGTCAGGAGAGGAGTTGGATGAACAG

AGCTGTGCTGTGGGGGCCAGACCCCCAGCTTCCCCTGAACCCTGCCATGGACCCCCGTGTCCTCCATA - UNI32265 - - UNI34564 - CTGGG

AGGCTGGCGAGTGGACATCCTGCAGCCGATCCTGTGGCCCTGGCACCCAGCACCGCCAGCTACTCTGCAGACAGGAATTCGGAGGTGGTGGCTCCTCGGT

ACCTCCAGAGCGCTGTGGACATCTCCCCCGGCCCAACATCACCCAGCCTTGTCAGCTGCACCTCTGTGGCCACTGGGAGATTAGCTCCCCCTGGAGCCAG

 - UNI31759 - - UNI34564 - TGCTCTGTGCGCTGTGGTCGTGGTCAGAGGAGCCGGCAAGTTCGGTGTGTTGGCAGTAATGGTGATGAGGTGG

ACAAGCAGGAGTGTGCTTCAGGGCCCCCGCCGCCCCCCAGCAGAGAGGCCTGTGACATGGGCCCCTGCACCACAGCCTGGTTCTACAGTGACTGGAGTTC

CAAG - UNI31759 - - UNI34564 - TGCTCAGCCGAGTGCGGGACAGGAATCCAGAGACGCGCTGTGGTCTGCCTTAGGAGTGGGGAGACCCTT

CAGGGAGACCCGGAAGCAGGAAGCACTGAGCAGGGCTGCCCTCTCAGAAGCCGCCCTCCCGATATGCGTGCCTGCAGTTTAGGGCCCTGTGAGAGGACAT

GGCGCTGGTTCACAGGCCCCTGGAGTGAG - UNI29109 - - UNI31232 - - UNI31759 - TGTTCCTCGGAGTGTGGGTCTGGCACACAAC

ACAGAGACATTATCTGTGTGTCCAAGCTGGGGGCCGAGTTCAATGTGACTTCTCCCAGCAACTGTTCCCACCTACCCAGGCCGCCTGCCCTGCAGCCCTG

TCAGGGGCAGGCCTGTGAGGACAAATGGTTCTCCACTCTCTGGAGTCCG - UNI31232 - TGTTCTCGATCCTGCCAGGGAGGCATGCAGACGAGGG

AAGTCCAGTGCCTGAGTGGCAACCAGACTCTCAGCTCCCGATGCCCTCCTCACCTGAGACCTTCCAGGAAGCGGCCCTGCAACAGCCAACCCTGCAACCA

GCGACCAG - UNI26002 - - UNI31232 - - UNI34497 - ATGACCAATGCAAGGACAGCTCTCCACACTGCCCCCTGGTGGTACAGGCCCG

GCTCTGCGTCTACCCCTACTACACAACTACCTGCTGCCGCTCTTGTGCCCATGTCCTGGAGCAGTCCCAGCTGGAACCGGCTTGAAACGGGTCCCAGAGA

CCCTGCCTTCGTGGTTTTCTTGTGCCACCCACTGACTAGCCCGCTCTGTACCCTCTGGCTTTTCACCTGGTCTCAGCCTTGCCAGAGGGATCCTCCAGGG

TGAGAGACCTACAGTGTGATAGCTCAAGAAGTGTACCTGACCTGCCTGGGGGTCTGTCCTGTGTATGTTTATCACTTCCACAAAAGCAGCTTGAGAAAGA

ATAGGAAGTGGGCGGTGCCTGTATCCCTCATGCTTTTCTGGGCTGGGGAGAAAGGGGGAGAGAGCAAGGTTATATTTCCACACTAATCTGAGCTACATAG

TGTGTGTCCCCCAGAAGTTCCAGGTCTGTGCCCCAATCCTCGTCTCCACATCTTCTAAATTACCCTGTTGTTCCCATCCCTGCCTTATCTAGTCTCTGTA

TTCCTACCTCCCTCATTAGCAGGGGCAGGGATCAGCCACTGCTACCCTACCTTACTGGGGAAGGACCACACCTCTCCAGGGCAGGGACCACTTGTGTCGA

GGGTGAAAAAGAGAAACGTCAGCATAAGACATCCTAGCCCCAGTCGCCACTTCACACTGAAAATGATGCCCACCCCAGAAGTAATTTATTTTTTATTAAA

GTTGGTTTTGACATAAA
Translation
 - UNI25134 - MESWLGR RLWLCMMLLLPLPQPCQDQE LFGPSHQLPSEEGQVPEGLWGPWGRWASCSQPCGVGVQRRSRTCELHPALPLPPRPP

RHPEAHRPRGQGSRPQTPRDPQSLYRPQPRGRGGPLRAPASQVGREETQEPQGAQR RFRVRDPIKPGMFGYGRVPFALPLHRSRRHPHRPGQPKNSSTG

EGMVPSQPPSTELASEKHGPHMQPPEPRSHSAETPRSGTAQTEVLPRTSSAPSYTGTPAPTSSFGDSRSFQGSLGPRMPPSPGSWSSPQGAERRHPPPFS

PVPRSQQSRRHWRPPGPHRSPDGWLPLTRDSSPLWSIFAPSIPAPNCSGESEQMRACSQE - UNI33224 - PCPPEQPDPRALQCAAFDSQEFMGQL

YQWEPFTEV - UNI31132 - - UNI33224 - VQGSQRCELNCRPRGFRFYVRHTEKVQDGTLCQPGSLDICVAGRCL - UNI31132 - - UN

I33205 - - UNI33224 - SPGCDGVLGSGRRPDGCGVCGGDGSTCRLVSGNLTDRGGPLGYQKILWIPAGASHLHISQLRPSSNYLA - UNI311

32 - - UNI33205 - ALRGPGGRSIINGNWAVDPPGSYTAIGTVFQYNRPPREEGKGESLSAEGPTTQPVDVY - UNI32246 - - UNI33205

 - MIFQEDNPGVFYQYVISSPPAVLESPSTKPPALQPQPE - UNI32246 - - UNI32265 - EMLRGEPLLPSAPRPVRAPGTLQRQVRIPQVP

PPTRVRTAMGSSAGYWKQVGHSECSASCGKG - UNI32246 - - UNI32265 - GVWHPIFLCISRESGEELDEQSCAVGARPPASPEPCHGPPCP

PY - UNI32265 - - UNI34564 - YWEAGEWTSCSRSCGPGTQHRQLLCRQEFGGGGSSVPPERCGHLPRPNITQPCQLHLCGHWEISSPWSQ -

 UNI31759 - - UNI34564 - CSVRCGRGQRSRQVRCVGSNGDEVDKQECASGPPPPPSREACDMGPCTTAWFYSDWSSK - UNI31759 - - 

UNI34564 - CSAECGTGIQRRAVVCLRSGETLQGDPEAGSTEQGCPLRSRPPDMRACSLGPCERTWRWFTGPWSE - UNI29109 - - UNI3123

2 - - UNI31759 - CSSECGSGTQHRDIICVSKLGAEFNVTSPSNCSHLPRPPALQPCQGQACEDKWFSTLWSP - UNI31232 - CSRSCQGGM

QTREVQCLSGNQTLSSRCPPHLRPSRKRPCNSQPCNQRPD - UNI26002 - - UNI31232 - - UNI34497 - DDQCKDSSPHCPLVVQARLC

VYPYYTTTCCRSCAHVLEQSQLEPA

For any suggestions or comments, please send an email to unitrap@crg.es