Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000015944 (Gats)
Chromosomal location
Chr 5: 134575618 - 134617626 (+)
Description
opposite strand transcription unit to Stag3 Gene [Source:MGI (curated);Acc:Gats-001]
RefSeq_dna
NM_030719 
RefSeq_peptide
NP_109644.2 
UniGene
Mm.45218 Mm.407215 Mm.473943 
MGI
MGI:1933384 
Uniprot/SWISSPROT
Q8CAB8 
Human Ortholog
ENSG00000160844 (AC073842.5-201)
Omim not available
UniTrap UNI25222
Vector Insertion
Chr 5: 134601813 - 134611020
Public Clones not available
Private Clones OST191427 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000016088
Sequence
TGCTGCTGCGCCGGGCGCCGCGCTCAGCCGGGCGCTGTTTGCTTGTCCACCCCGTAGCTTGCTGCACCCCGCAGGTCCTCCCCAGGCCTCCTTTTTTTGC

AACTTGCCAAGCTTCCTTTTTCTGGCTCGAGTACGAATCAACCCGGCATCGAGCTCCGGGCCCCCTTCCCTGGGCCGGTTGCCCCACGGCTTGGGGCGCA

CAGGGGGCGGGGGCCGCGGCTCGTCCCCGTCCCCCCCCCCCCAACTCGGGCCACCGCGGATGATCCGCCGTGGAGGAGCCCTGGGCGGACGATGGAACTG

CACATTCTGGAACACCGGCTGCAAGTTGCCAGCGTCGCCAAGGAGAGTATCCCGCTCTTCACCTACGGCCTCATCAAACTTGCCTTCCTGTCTTCCAAGA

CCAG GTGCAAGTTTTTCAGTCTGACCGAGACCCCTGAGGACTACACCATCATCGTAGATGAGGAGGGTTTCCTTG - UNI25222 - AGCTACCCTC

CTCAGAGCACCTGAGTGTGGCTGATGCCACCTGGCTGGCCCTGAACGTGGTGTCCGGTGGCGGCAGCTTCTCCAGCTCCCAGCCCATCGGTGTGACAAAG

ATTGCCAAGTCTGTCATTGCCCCACTCGCCGACCAGAACATCTCCGTGTTTATGCTGTCCACCTATCAAACTGACTTCATCCTG GTGCGGGAGCGGGAC

CTGCCCTTCGTCACTCACACCTTGTCCTCGGAGTTCACCATCCTACGCGTTGTCAATGGAGAAACGGTGGCGGCTGAGAATCTCAGCTTCACCAATGGCT

TTGTGAAGCCCAAGATGG TCCAGAGGCCAGTCATCCACCCACTGTCTAGCCCAAGCAACAGGTTCTGTGTCACCAGCCTGGACCCTGACACACTGCCCG

CCGTCGCCACCCTTCTCATGGATGTGATGTTCTACTCCAATGG AGTGAAGGACCCCATGGCTGCCAGTGACGATTGTGGCCACATCCGCTTCTTCTCCT

TCTCACTCATTGAGGGCTACATCTCACTGGTGATGGACGTACAGACCCAGCAGAG GTTCCCGAGTCACTTGCTATTCACGAGTGCATCTGGAGAGCTCT

GGAAGATGGTGCGCATAGGAGGACAACCCTTGGGATTTG ATGAATGTGGGATTGTAGCCCAGATCTCAGAGCCCTTGGCAGCTGCAGACATCCCAGCAT

ATTACATCAGTACTTTCAAGTTCGACCATGCATTG GTTCCAGAAGAGAATATCAGTGGGGTTATCCATGCCCTGAAGGTCAGTCAAGCAGGGAAGCATT

AGACTCGTCTCTGGGCTCCTCCCTGCCACAGCCCACCTGGGCCTTTCCCCCCACGAAGGTTATTCTTGCAGTATTTCCCTATGGACTGAAAGCTCGGCCC

CAGGACCTTTAAGGAAGGGGCCTCTGGGACACTCCCCTGATTCCTGACTCCTCCAGGCCTGGGCCTGAGCTAGGGCCACCCCCACATCCTCCTCCTGCCT

TCCAGAGTCCCCAGCCTTTTCAGTAATGACTCTGTTTCCGCTCGGTGGGGGTGTGCCCATCTTCCTCCCCCAAGTTCCACCCCAGAAAGCGGTCTCCGAG

GCCCAGGACACTTGGGACCAGCCCAAGGCCTCACCTACAGCCCGCAGCAAACACCAAAGGAAGCTGGCACCTCCTGTGAGACACTGGGATCGGGGTCCTG

ATGCACCTAGGGACATCTTAGGGAGTTGGTGGAGCAAGATTGGGGGTACAGAGCTGGGGAAGCCCCCGTGAGCCCCCCCTTGAATTGATGGTTATGGTTG

CTGCTCTAGTTTTAGAGGTTCAGGGGCTGGTTCCCTCAGAATGGAGGTCAGCAGGCCACCCTCAGGTCATAATGGCCAGTGAGCCTCAGACAGTAGCAGT

GGGGTTCCTACTCCTAAGCTGGGGAGGAAAGGCAAGACTCTAGACCCCCACCTGCTGACCACACAGGGCCTGTGTCGATTTCCTCTACAACTGCCAAGAG

GGGCCCTGGGCCAAACTTCCCCCCAGAGCACTTGTCCCTGGAGGGGATCCCAGGACACCCCCTCTCCCACCAGCCTAGAGCGCCAGCTTCTATCTGTCCT

TTGTTCGCTCTCCCCAGACCCATCATGGGCAAGCAAAGACTCGGCTTCTTTCAGCGGTGGGCATCCCCACCTGCCCAGGCCTAGGGTGCCTTGGGCCATG

TCCCACCTCCCCAGCTGTCACTTAGACCAGCCTAGAGAATTCCCCATCATCCTCTCTGCCCCACTTTTAGGGGATAAAGAGGCCTCAGCCCCCACAGCTC

ATATACCTGCCCGAAATACACACAGCAATCTGTGGTCACGGTGATAACCTGGGAGGCAGCTATCTTCAAGCATTTGTAGAGAGACATTACCCCTGCGGGG

TTTCTTCTTCGTTGTCTTTGCATACAGGTGGCTGGGGAAAGAGTAGTTTTGTTTGGAGGGGATGGAGCCTGTTTGAGTCTTATTAGGGTACCCAGTGTTC

AGTGAGACTTAGCACCCTGTGTCTCTGGGGACAGACACAAATGCAAAGATGTATCGTAAGACTCTTGGCCGTGTCTTCTGAGGAGGGCTAGTGGGAGCAG

AGCTCTGATACAAGACACCAGGACCCCATAGCACCCCCTGCAGGGCATGCCAGTGTTCCACCACCTTCATATGGCGCTGTTAGCTGGGACTGCGGGGGGT

CCACCAGACTTTTTGCTCTTGGGGTGTTTTGTCGAGCCTGTGCTTCACGATCTCCAACAACAAGGTCAGAGGAGGGAATGTTTATCTACCCCTGCACAGT

CTTGTACAAACTGTGTTTCCCTCCTCTCTGGGCCACAGAAACACACCCAGAGGAACTCTTCTAGAATCATGTAGAAGCCAGAACCCAGCATGTTAATCAA

AATCAACTCTGGTTGGTTTTGGTTTTGGTTTTTTTTTTTTGTTGTTGTTGTTGTTGTTGTTGTTTTTTAACTCCTTTTGCACAAAACCCTTAAAACCAAA

TCTTATTATTTTCTGGTCCCGAATGGGAAATGGCCAAGTGGGCGGGGCTTTATAGTGAGGCCCCTGAGTCCCCTTTTTCTCTCTCTGGAAGGCCTTGATT

GTCCGGGGTACACATCTCCAGAACCCCTCCTGTCTCCCTTTCCAGTCATCCCTTCCCACCATATAAGTGTGCTGGCCCCCTGCCCCCTGTGTGGACCCCT

AGACTTGCTAGGATGAGACTGTGTATTGTACACACCTATAAATACATGTTTTATGTTGATAGAGATATATTCTGTAAATAGCATATATACTTGAGCAATA

TATATGTTAATATATTCTGTGTGCGCAGGACACAGGCAAGGGCCCCCACCTCATGTGCGCACACTCGGGGACATTTTGAGCCACCGTATATTTTTAATTC

AAATACGTAGGCAATACGATGAGTGAAAAAGCCCTGGGGTCCTGAGGCCAGCCTGGAGGGGAGACAGAACCAACAACCTACCGCAAGTGGGGCAGGCTGA

GAGGGCCAGTGTAGTCTGCTTCATAGCTACTGTACCCCCATTTCCACAGCCTAGAGCTCTGGATGCCTTCATTTTATTTGGGAGGGGGGGCACTGATCCA

GAGGAGGGATTGGGTTTTTTTGTTGTTGTTGTTGTTGTTGGGTTTTGTTTTTGGTTTTGGTTTTTGGTTTTGTTAACAGTGGCTCCCTCCCTCAGGGTTA

CCCCAAAACCTTTGTCTGGTAAACCCATCTGTCCCAGCCTGCCTCCCTCCCAAGTCCCTTCTCCATAGAAAGCTATAGACCTGGCATCTTACCTGACTTT

TGTTGTTATTGTTGTATTGTTTTCTTGAGGCAGGGTCTCTTTAGATAGCCCTGGCTATCCTGGAACTCTCTTTGTAGACCAGGCTGGCCTTGAATTGATA

GGACTCTACCCGCCTCTGCCTCCCGAGTGCTGGGATTAAAGGTGTGTGCCATCACACCTAAGTTTTTTTTTAATATTATTATTAATATTATTATTCCTGC

AAGCTTAGGAATCTCAGGTTCTCTTCCCTGCTCTCTTCCTAGGACTGACTCCATAAGGACCCAGACCACCACACATACTCCCACGGTTGTGTGTCCAGAA

AGGGCTGGGCCTGGCTTCTGCCGGCCAACCTTTTAAGGGACCGCACTGCTGTTCAGCTGCAGTGGGTCCTTGGAGGAAGCTAGCTCTGTTTCTGTGTTCT

GTGGGTAGATCAGCATGGTGTGGTGTCTTCAGTTCTGGGGGATGTGACAGTCCCTCTACTAGTAGAGGCCCTCTACTCTCGTGTTTTTTAGCACTGTCTG

CTCTCTTTTCAGCATCTTCTGGTTTTATGAATATGAAGGATGACTCCACCCCCTGCTAACCCAGCCTCAGAGGGGACCCAAGTGTCACACCACTCCGAAG

TCAGGGTTCCCTAGAGGATTTCTTTTGTGTTTTTCTGCAGTGCTGAGGAATGTAGGCAGGGCCTCCTGCGTGAGAGGCAAGTACTCCACAGAGCCACTCC

CAGATCCTCGCAGCAGAGTCTCTCGGCTCACAGGGAGGGTAGGAGATTGGGCTGTTAAGAAGGTAAAGTTTTAGGAACCGCAGTCAGGAACCCCCTGGGT

TGGGCTACCAAGTCCCGAACTCTGGGGGTACTCTATCAGGAAAGCGCACTTCAGGAGTTGCTCAGTGGATAGGGTGTTCCCATAGCATTATTCCCAGCAC

TCGGGAGATGAAAGCAGTCAGATCACAAGTTAAGGTCAGCCTGGGCTACATGAGGCTCTGTCTC
Translation
MELHILEHRLQVASVAKESIPLFTYGLIKLAFLSSKTR RCKFFSLTETPEDYTIIVDEEGFLE - UNI25222 - ELPSSEHLSVADATWLALNVVS

GGGSFSSSQPIGVTKIAKSVIAPLADQNISVFMLSTYQTDFIL VRERDLPFVTHTLSSEFTILRVVNGETVAAENLSFTNGFVKPKMV VQRPVIHPLS

SPSNRFCVTSLDPDTLPAVATLLMDVMFYSNG GVKDPMAASDDCGHIRFFSFSLIEGYISLVMDVQTQQR RFPSHLLFTSASGELWKMVRIGGQPLGF

D DECGIVAQISEPLAAADIPAYYISTFKFDHAL VPEENISGVIHALKVSQAGKH

For any suggestions or comments, please send an email to unitrap@crg.es