Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000015961 (Adss)
Chromosomal location
Chr 1: 179693309 - 179726640 (-)
Description
adenylosuccinate synthetase, non muscle Gene [Source:MGI Symbol;Acc:MGI:87948]
RefSeq_dna
NM_007422 
RefSeq_peptide
NP_031448.2 
UniGene
Mm.338021 Mm.470004 
MGI
MGI:87948 
Uniprot/SWISSPROT
P46664 
Uniprot/SPTREMBL
Q8C909 
Human Ortholog
ENSG00000035687 (ADSS)
Omim not available
UniTrap UNI7919
Vector Insertion
Chr 1: 179715130 - 179726342
Public Clones (sanger) RRM133 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11866
Vector Insertion
Chr 1: 179707011 - 179712973
Public Clones W064D01 (ggtc) A069D01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1849
Vector Insertion
Chr 1: 179706696 - 179706943
Public Clones AZ0664 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1017
Vector Insertion
Chr 1: 179703833 - 179705711
Public Clones AY0752 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5003
Vector Insertion
Chr 1: 179694429 - 179697785
Public Clones YTC405 (baygenomics) IST12372F5 (tigm)
Private Clones OST436185 (lexicon)
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000016105
Sequence
GGCCGGCCTCTGGCTCCTTCTTCCTCCGCATGTGGCTGGTGGCGGCGCAGCAGTTGGGTTCACGTTCCGTTCTCCTGCCCCGTCTCCTTAAGGCTCTTCT

GCCCTGCCGGGAGCCATGTCGATCTCCGAGAGCAGCCCGGCGGCCACCTCCCTGCCCAACGGCGACTGTGGCCGCCCCAGGGCGCGGTCCGGAGGGAACC

GGGTGACTGTGGTGCTGGGAGCGCAGTGGGGCGACGAGGGCAAAGGGAAGGTGGTGGATCTACTGGCGCAGGACGCCGACATCGTGTGCCGCTGCCAG -

 UNI7919 - GGAGGGAATAACGCTGGCCACACAGTTGTCGTAGATTCTGTGGAATATGACTTTCATCTTTTACCTAGTGGAATAATTAACCCAAATGT

TACTGCCTTTATCG GAAATGGAGTGGTAATTCATCTTCCTGGATTGTTTGAAGAAGCGGAGAAAAATGTTCAGAAGGGAAAAG GTCTAGATGGCTGGG

AGAAAAGGCTTATCATATCGGACAGAGCTCATATTG - UNI11866 - TGTTTGACTTTCATCAAGCAGCTGATGGTATCCAGGAACAGCAGAGACAA

GAGCAAGCAGGAAAAAA - UNI1849 - TTTGGGTACCACGAAAAAGGGGATTGGCCCTGTGTATTCCTCTAAAGCTGCTCGGAGTGGACTTCGGATG

TGTGATCTTGTTTCTGACTTTGATGGCTTCTCTGAGAG GTTCAAAGTTCTAGCTAACCAGTATAAATCTATATACCCGACTTTGGAAATAGACATTGAA

GGTGAATTACAGCAACTCAAG - UNI1017 - GGTTATATGGAAAGGATTAAACCGATGGTGAAAGATGGAGTTTATTTCCTATATGAGGCCCTCCAT

GGACCACCCAAGAAAATCTTGGTAGAAGGTGCAAACGCAGCATTGTTAGATATTGATTTTG GAACTTACCCTTTTGTAACCTCTTCAAACTGTACTGTT

GGAGGTGTTTGTACAGGTTTGGGCATGCCCCCTCAAAATGTTGGAGAAGTATATGGAGTTGTGAAAGCTTACACCACTAGAGTTGGTATTGGTGCCTTTC

CCACAGAGCAAGACAAT GAAATTGGAGAATTATTACAAACACGGGGTAGAGAATTTGGAGTAACTACTGGAAGGAAAAGAAGATGCGGCTGGTTGGACC

TTGTTTCACTCAAATATGCTCATATGATCAATGGATTTACTGC GTTGGCCCTTACCAAGTTGGATATTTTGGATATGTTTACGGAAATCAAAGTTGGAG

TTGCTTACAAATTAGATGGGGAAACCATACCTCATTTCCCAG CAAACCAAGAAGTCTTAAATAAAGTGGAAGTTCAGTATAAGACTCTCCCAGGATGGA

ACACAGACATATCTAATGCAAGGACATTTAAGGAGCTACCTGTCAACGCACAAAACTATGTTCGGTTTATTGAAGATGAGCTTCAAATACCAG - UNI5

003 - TTAAATGGATTGGTGTAGGTAAATCCAGAGAGTCCATGATTCAGCTCTTCTAAGGATTGCCAGCAACGCATGAGACACTCCTTAAGAGGAAGGG

AAAAAGACTTAAACATTTCTTTGTGATCTGCAAATTCAAGAATAAAGACATTGAAATGAGTTTTCAGCTGGCGTTGGTTTGCAGTTTCTGATGGATGGCT

GTCATGGCCGGCCTTGTGCTCTCATCCAGCTTCCCGGCTGGCATGGCTGCCACATCTGTTGCTCTGCTTCTCATGGTGCCGCACAGTCCTTGCCATGGTT

AGAACTGTATAATCCCCAGTTGACATCTAGAACTTCCAGTGTAGCTTTTCTTCATTATGGCCGTTGTGTTTGAGGTTGTACCCCGATTAGATGGTGAGAA

CAGTTAATGCAATTTTGCACAAATATTTTTACATTCTGATCATTCACTTCTGTCATTGTGATCTTTGCTGTTAGAAAAAGAAATGATGGAAAGATAAGGG

TTCTGTCAACATTTGTAAAGCTAAGAATTCTGTTTAAATTGTGAACTGCTTTTTTTTTTCCTCTGCTGAAACCATTGCAAAATTGAGCTTTGGTAGGGTA

GGGGGAGTATGTTCATGAGACTTTTAATTTGTATAAAACACAGAACTTAGTTCTCTCTGCAATTTATTTAATACAGTCAACATTAAATTGAGTGTTCAAA

AAGAAGAGATGTTTCCCTACAATAACAACCTTAATGTGAGAAAATAATTATTAAAAAAAAATCTGTTGTGATATTTGATGGATATTTTTCTTTGTTTTCA

GATATGATCTCAAATGTTTGTCTTTTCTTTTTCTTTTTTAAGCATACTGTTGTTTCTAAGAACAGTGGGTTTGCTTACATTTCGCCTGCCAGTATACCTA

CAAAATGACCCACAAGTAACCCGCATGAGTCCAAGTTGTCAGCCATATTTTGATCATGCCCTCATCCCTCCTTTCTTGAAAAAGCAAAGAGGGATCACCT

GGCCCTTGGCTTTACATTGTGCTGAGATTAGCCTTCCCTGGACCATTAAATGTTTAAATTAGGCATCACCTGAAATTATTTTATAATACCACCAACAGCT

GATTAAAAGCAACCAAATATTTCCAG
Translation
MSISESSPAATSLPNGDCGRPRARSGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRCQ - UNI7919 - GGNNAGHTVVVDSVEYDFHLLPSGII

NPNVTAFIG GNGVVIHLPGLFEEAEKNVQKGKG GLDGWEKRLIISDRAHIV - UNI11866 - VFDFHQAADGIQEQQRQEQAGKN - UNI1849

 - NLGTTKKGIGPVYSSKAARSGLRMCDLVSDFDGFSER RFKVLANQYKSIYPTLEIDIEGELQQLK - UNI1017 - GYMERIKPMVKDGVYFLY

EALHGPPKKILVEGANAALLDIDFG GTYPFVTSSNCTVGGVCTGLGMPPQNVGEVYGVVKAYTTRVGIGAFPTEQDN EIGELLQTRGREFGVTTGRKR

RCGWLDLVSLKYAHMINGFTA ALALTKLDILDMFTEIKVGVAYKLDGETIPHFPA ANQEVLNKVEVQYKTLPGWNTDISNARTFKELPVNAQNYVRFI

EDELQIPV - UNI5003 - VKWIGVGKSRESMIQLF

For any suggestions or comments, please send an email to unitrap@crg.es