Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000016386 (Mpped2)
Chromosomal location
Chr 2: 106533426 - 106708513 (+)
Description
metallophosphoesterase domain containing 2 Gene [Source:MGI (curated);Acc:Mpped2-001]
UniGene
Mm.397826 Mm.45628 
MGI
MGI:1924265 
Uniprot/SWISSPROT
Q9CZJ0 
Uniprot/SPTREMBL
B1APT0 B1APT1 B1APT2 
Human Ortholog
ENSG00000066382 (MPPED2)
Omim not available
UniTrap UNI32635
Vector Insertion
Chr 2: 106533979 - 106535757
Public Clones 5SE048A08 (ggtc) 3SE048A08 (ggtc) IST11596F3 (tigm) IST10729C10 (tigm)
IST12948G4 (tigm) IST13209F1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19460
Vector Insertion
Chr 2: 106539444 - 106539693
Public Clones not available
Private Clones OST390849 (lexicon) OST372115 (lexicon) OST299067 (lexicon) OST190778 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20275
Vector Insertion
Chr 2: 106539693 - 106584856
Public Clones not available
Private Clones OST368417 (lexicon) OST271457 (lexicon) OST46333 (lexicon) OST29702 (lexicon)
OST29674 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18248
Vector Insertion
Chr 2: 106585039 - 106623789
Public Clones not available
Private Clones OST426971 (lexicon) OST392916 (lexicon) OST38559 (lexicon) OST36251 (lexicon)
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25953
Vector Insertion
Chr 2: 106624016 - 106701644
Public Clones IST13985H9 (tigm)
Private Clones OST149371 (lexicon)
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21575
Vector Insertion
Chr 2: 106701761 - 106704811
Public Clones not available
Private Clones OST325534 (lexicon) OST255506 (lexicon)
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111065
Sequence
TGACCCAGGGAGCACCAGCAGCCTGCGGGCCTCGCCCTCCGCTCTCCCTCCTCTCCTGGAAACCCCGCGGCCTCGGGGCGTGGGTGGGGGGTTCGAGTGG

GCCGGAACTACGGCAGGGGCGTGCAGGGCGCGGGGTCCCAGCGGGGAGCTCACAGCAAGCGGCGCCTGGGCGGCCCTGCTTCCTGGAGCTGTGCTCCTTT

GACCCCAGTGGCAGTCCCTGTCACTGCACCGCTCGCGCTCCCTTCGCTCGCCGCGCCCTCGCTGCCTCTCCTCGCCCCCTCGCTCCTTCTCTTCCCAGAT

CGAGGCTGCTCCGGTCCTCTCCACCTCCCCACGCAGCGACCCCGCGTCCCGCTCGCACCGCGCCCCTGTGCTGCCCTCCCAGGCCCTGGATCGGCGGCGG

GGACCTCCGGGGTCGAAGGTTCTGGCCCGCCCGCGCCCCTCGCCCCTGCCGCCCCCAGCGCTGCTCCAAGCCGGCTCGGGTTGCTTGGCGATGGCTCGCC

CGCACACCGGGCGCTGAAGGCATCCCGGGGACCCGGAGCGCAGCCC - UNI32635 - CTAGAACGCACAGTGGTATTGATGAGTAGACCCTTGGATT

CAGAGGTTGGCTGAAACCCATCATGCCCGCTTCCAGCTTTTGCTCCGGAGAGTTGTGAATTGCTCATGCCTGTAGGGAGGAAGGATGGCACATGGGATTC

CTTCTCAAGGCAAAGTTACCATAACGGTGGATGAGTATAGCTCAAACCCCACCCAGGCATTCACACACTACAACATCAACCAGAGCAGATTCCAGCCGCC

ACATGTACATAT - UNI19460 - - UNI20275 - GGTCGACCCCATCCCATATGACACTCCAAAACCAGCGGGCCACACGCGGTTTGTCTGCATC

TCAGACACACACTCCAGAACAGATGGTATCCAGATGCCTTATGGGGACATCCTTCTCCACACAGGCGATTTCACCGAGCTGGGACTGCCCTCAGAGGTTA

AGAAGTTTAATGACTGGTTAG - UNI18248 - GAAACCTGCCATATGAATATAAAATTGTGATTGCTGGGAATCATGAACTGACATTTGATAAGGAA

TTCATGGCAGACCTCGTTAAACAGGACTACTACCGTTTCCCTTCTGTGTCCAAATTGAAACCAGAGGACTTTGACAATGTTCAGTCCCTCCTGACAAACA

GTATTTACTTGCAAGATTCAGAGGTAACCGTGAAAGGATTCAGGATATACGGTGCACCCTG - UNI25953 - GACCCCGTGGTTTAATGGATGGGGC

TTTAACCTACCCAGAGGCCAGTCTCTGCTGGACAAATGGAACCTAATCCCTGAGGGCATCGACATACTCATGACACACGGACCTCCTCTAG - UNI215

75 - GTTTTCGAGACTGGGTTCCAAAGGAACTTCAAAGGGTGGGCTGCGTGGAGCTCTTAAACACAGTCCAGAGGCGCATTCGGCCCAAGCTCCATGTG

TTCGGTGGGATTCACGAAG GGTACGGCATCATGACCGACGGTTACACCACCTACATCAATGCCTCAACCTGTACAGTCAGCTTTCAACCGACCAACCCT

CCAATCATATTTGACCTTCCAAACCCACAGGGCTCCTAAAGCACTCAGCATCCCGTTGGAATGTGAGGGACGGTCTACAAACTGCCATTTTTCTAATTAT

AAACTCACATTCTCTGATTTGTTTATTTCTAAATCCTGTGAGTTCTTTTTGTAAATTGTTGGAACAGGAGGGAAAAGAAAAAAGAAAAAAAAAAAGATGC

TAGCGTTGTGCCGCCTCTTTTTTGCTTTTTTGAGTGGGGTATCCATTTGAAATCAAAGGAACATTGTGAATTTGTAAAATGACTTCTGTTTGCTCAAAGG

CCACGCCATTGTAAATTGTTAGTATTTGCCAAAGGACAGCCAAGCTTTCTTTAAAAAAAAAATGATTATTTTAAAAAGTCTTATTTGAATATGCTTTAAG

CTGAAAGGAAAAGATTAAAAAAAAAAAAAAGACAGAAAGAAACACAAAAGCAGTGTTTTGAAAAATCACCCAGATTTGCACAACTCTGAGTATTGTTTGA

TATGTTTTAATTTTCAATGTTTTGTTGTTGTTTTCTTGGTATTGCCTCATTTTTATTTTACAAATGTGGCCCCAATTTAGAGCAATCTCAACAGAAGTTG

GTTAGGAAAAACCTTAGCTTCTCTCTGGCTATAAAGAAGACTGTGTCTGAGGTGGGGGAAGAACAGCCCTCATGCAGAGGCTTAGCCAGAGATCCATATC

ATGATGCTACCAACTCTCACTGTTTGTTTCTTTTAAATTATTTGAGCTTTAAAAATAAGGAAACAAGAATCTGTCAAGAGATGGTCATGCAAGGAAAAAG

AAAGTGTGCAGACTCCCTTTCCATGTGGATTTATATATATATATATATAACTATTTTTTGTGCATTACGACTCAGTTGGGAGTTTAATCTTGCCAAGGAC

AGTACAACTGCAAAGCCACATCGGTAGCAGCACACCAGACGTCTGAAGGAACTGACCCATTCTTTCTTCAAACTCAAGGTCTTAAAGAACTTGAGTCCAG

TCTAGGTACAGTAACCAGTGTGTATAGACTCCAGTGGATGCATCGGAAGCGAACTAAATAAGGCTTAGTCGTCCTTTCTATTTAAAGGCCCTGTTTTGTC

TTCTCACTCCCCTCCCCCTCCCATTTTGCACTGTGTGTTGATGCAATCTTCGCTAGCACAAAATATTGTTGCTAATAATCCTTTCTGGTCTCCCATTGTC

GATGCCATTGAGCGCTATTCTATTTTATGTTACCTTCAAATTTAGGAAAGCAGTTGTTTTCTTTAAATTTATTGTGATACTCTATATCTAGCGGCCTTTA

TATGCAAATAAAATTGCAAGATTTTT
Translation
 - UNI32635 - MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHM - UNI19460 - - UNI20275 - MVDPIPYDTPKPAGHT

RFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLG - UNI18248 - GNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSK

LKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPW - UNI25953 - WTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLG - UNI2157

5 - GFRDWVPKELQRVGCVELLNTVQRRIRPKLHVFGGIHEG GYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS
Transcript ENSMUST00000111063
Sequence
TGACCCAGGGAGCACCAGCAGCCTGCGGGCCTCGCCCTCCGCTCTCCCTCCTCTCCTGGAAACCCCGCGGCCTCGGGGCGTGGGTGGGGGGTTCGAGTGG

GCCGGAACTACGGCAGGGGCGTGCAGGGCGCGGGGTCCCAGCGGGGAGCTCACAGCAAGCGGCGCCTGGGCGGCCCTGCTTCCTGGAGCTGTGCTCCTTT

GACCCCAGTGGCAGTCCCTGTCACTGCACCGCTCGCGCTCCCTTCGCTCGCCGCGCCCTCGCTGCCTCTCCTCGCCCCCTCGCTCCTTCTCTTCCCAGAT

CGAGGCTGCTCCGGTCCTCTCCACCTCCCCACGCAGCGACCCCGCGTCCCGCTCGCACCGCGCCCCTGTGCTGCCCTCCCAGGCCCTGGATCGGCGGCGG

GGACCTCCGGGGTCGAAGGTTCTGGCCCGCCCGCGCCCCTCGCCCCTGCCGCCCCCAGCGCTGCTCCAAGCCGGCTCGGGTTGCTTGGCGATGGCTCGCC

CGCACACCGGGCGCTGAAGGCATCCCGGGGACCCGGAGCGCAGCCCGGGAAAG - UNI19460 - - UNI32635 - AACGCACAGTGGTATTGATG

AGTAGACCCTTGGATTCAGAGGTTGGCTGAAACCCATCATGCCCGCTTCCAGCTTTTGCTCCGGAGAGTTGTGAATTGCTCATGCCTGTAGGGAGGAAGG

ATGGCACATGGGATTCCTTCTCAAGGCAAAGTTACCATAACGGTGGATGAGTATAGCTCAAACCCCACCCAGGCATTCACACACTACAACATCAACCAGA

GCAGATTCCAGCCGCCACATGTACATAT - UNI19460 - - UNI20275 - GGTCGACCCCATCCCATATGACACTCCAAAACCAGCGGGCCACAC

GCGGTTTGTCTGCATCTCAGACACACACTCCAGAACAGATGGTATCCAGATGCCTTATGGGGACATCCTTCTCCACACAGGCGATTTCACCGAGCTGGGA

CTGCCCTCAGAGGTTAAGAAGTTTAATGACTGGTTAG - UNI18248 - GAAACCTGCCATATGAATATAAAATTGTGATTGCTGGGAATCATGAACT

GACATTTGATAAGGAATTCATGGCAGACCTCGTTAAACAGGACTACTACCGTTTCCCTTCTGTGTCCAAATTGAAACCAGAGGACTTTGACAATGTTCAG

TCCCTCCTGACAAACAGTATTTACTTGCAAGATTCAGAGGTAACCGTGAAAGGATTCAGGATATACGGTGCACCCTG - UNI25953 - GACCCCGTG

GTTTAATGGATGGGGCTTTAACCTACCCAGAGGCCAGTCTCTGCTGGACAAATGGAACCTAATCCCTGAGGGCATCGACATACTCATGACACACGGACCT

CCTCTAG - UNI21575 - GTTTTCGAGACTGGGTTCCAAAGGAACTTCAAAGGGTGGGCTGCGTGGAGCTCTTAAACACAGTCCAGAGGCGCATTCG

GCCCAAGCTCCATGTGTTCGGTGGGATTCACGAAG GGTACGGCATCATGACCGACGGTTACACCACCTACATCAATGCCTCAACCTGTACAGTCAGCTT

TCAACCGACCAACCCTCCAATCATATTTGACCTTCCAAACCCACAGGGCTCCTAAAGCACTCAGCATCCCGTTGGAATGTGAGGGACGGTCTACAAACTG

CCATTTTTCTAATTATAAACTCACATTCTCTGATTTGTTTATTTCTAAATCCTGTGAGTTCTTTTTGTAAATTGTTGGAACAGGAGGGAAAAGAAAAAAG

AAAAAAAAAAAGATGCTAGCGTTGTGCCGCCTCTTTTTTGCTTTTTTGAGTGGGGTATCCATTTGAAATCAAAGGAACATTGTGAATTTGTAAAATGACT

TCTGTTTGCTCAAAGGCCACGCCATTGTAAATTGTTAGTATTTGCCAAAGGACAGCCAAGCTTTCTTTAAAAAAAAAATGATTATTTTAAAAAGTCTTAT

TTGAATATGCTTTAAGCTGAAAGGAAAAGATTAAAAAAAAAAAAAAGACAGAAAGAAACACAAAAGCAGTGTTTTGAAAAATCACCCAGATTTGCACAAC

TCTGAGTATTGTTTGATATGTTTTAATTTTCAATGTTTTGTTGTTGTTTTCTTGGTATTGCCTCATTTTTATTTTACAAATGTGGCCCCAATTTAGAGCA

ATCTCAACAGAAGTTGGTTAGGAAAAACCTTAGCTTCTCTCTGGCTATAAAGAAGACTGTGTCTGAGGTGGGGGAAGAACAGCCCTCATGCAGAGGCTTA

GCCAGAGATCCATATCATGATGCTACCAACTCTCACTGTTTGTTTCTTTTAAATTATTTGAGCTTTAAAAATAAGGAAACAAGAATCTGTCAAGAGATGG

TCATGCAAGGAAAAAGAAAGTGTGCAGACTCCCTTTCCATGTGGATTTATATATATATATATATAACTATTTTTTGTGCATTACGACTCAGTTGGGAGTT

TAATCTTGCCAAGGACAGTACAACTGCAAAGCCACATCGGTAGCAGCACACCAGACGTCTGAAGGAACTGACCCATTCTTTCTTCAAACTCAAGGTCTTA

AAGAACTTGAGTCCAGTCTAGGTACAGTAACCAGTGTGTATAGACTCCAGTGGATGCATCGGAAGCGAACTAAATAAGGCTTAGTCGTCCTTTCTATTTA

AAGGCCCTGTTTTGTCTTCTCACTCCCCTCCCCCTCCCATTTTGCACTGTGTGTTGATGCAATCTTCGCTAGCACAAAATATTGTTGCTAATAATCCTTT

CTGGTCTCCCATTGTCGATGCCATTGAGCGCTATTCTATTTTATGTTACCTTCAAATTTAGGAAAGCAGTTGTTTTCTTTAAATTTATTGTGATACTCTA

TATCTAGCGGCCTTTATATGCAAATAAAATTGCAAGATTTTTAAA
Translation
 - UNI19460 - - UNI32635 - MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHM - UNI19460 - - UNI20275 - MVD

PIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLG - UNI18248 - GNLPYEYKIVIAGNHELTFDKEFMADL

VKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPW - UNI25953 - WTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGP

PLG - UNI21575 - GFRDWVPKELQRVGCVELLNTVQRRIRPKLHVFGGIHEG GYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS
Transcript ENSMUST00000016530
Sequence
AGGAGAAAAGTCGTGCCCTCCCTCTCCGAAAGAATGTGCCAGCTGGGTGTCAGCAGTGCTGGAGACAAGTTCAGGT - UNI19460 - AACGCACAGT

GGTATTGATGAGTAGACCCTTGGATTCAGAGGTTGGCTGAAACCCATCATGCCCGCTTCCAGCTTTTGCTCCGGAGAGTTGTGAATTGCTCATGCCTGTA

GGGAGGAAGGATGGCACATGGGATTCCTTCTCAAGGCAAAGTTACCATAACGGTGGATGAGTATAGCTCAAACCCCACCCAGGCATTCACACACTACAAC

ATCAACCAGAGCAGATTCCAGCCGCCACATGTACATAT - UNI19460 - - UNI20275 - GGTCGACCCCATCCCATATGACACTCCAAAACCAG

CGGGCCACACGCGGTTTGTCTGCATCTCAGACACACACTCCAGAACAGATGGTATCCAGATGCCTTATGGGGACATCCTTCTCCACACAGGCGATTTCAC

CGAGCTGGGACTGCCCTCAGAGGTTAAGAAGTTTAATGACTGGTTAG - UNI18248 - GAAACCTGCCATATGAATATAAAATTGTGATTGCTGGGA

ATCATGAACTGACATTTGATAAGGAATTCATGGCAGACCTCGTTAAACAGGACTACTACCGTTTCCCTTCTGTGTCCAAATTGAAACCAGAGGACTTTGA

CAATGTTCAGTCCCTCCTGACAAACAGTATTTACTTGCAAGATTCAGAGGTAACCGTGAAAGGATTCAGGATATACGGTGCACCCTG - UNI25953 -

 GACCCCGTGGTTTAATGGATGGGGCTTTAACCTACCCAGAGGCCAGTCTCTGCTGGACAAATGGAACCTAATCCCTGAGGGCATCGACATACTCATGAC

ACACGGACCTCCTCTAG - UNI21575 - GTTTTCGAGACTGGGTTCCAAAGGAACTTCAAAGGGTGGGCTGCGTGGAGCTCTTAAACACAGTCCAGA

GGCGCATTCGGCCCAAGCTCCATGTGTTCGGTGGGATTCACGAAG GGTACGGCATCATGACCGACGGTTACACCACCTACATCAATGCCTCAACCTGTA

CAGTCAGCTTTCAACCGACCAACCCTCCAATCATATTTGACCTTCCAAACCCACAGGGCTCCTAAAGCACTCAGCATCCCGTTGGAATGTGAGGGACGGT

CTACAAACTGCCATTTTTCTAATTATAAACTCACATTCTCTGATTTGTTTATTTCTAAATCCTGTGAGTTCTTTTTGTAAATTGTTGGAACAGGAGGGAA

A
Translation
 - UNI19460 - MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHM - UNI19460 - - UNI20275 - MVDPIPYDTPKPAGHT

RFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLG - UNI18248 - GNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSK

LKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPW - UNI25953 - WTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLG - UNI2157

5 - GFRDWVPKELQRVGCVELLNTVQRRIRPKLHVFGGIHEG GYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS

For any suggestions or comments, please send an email to unitrap@crg.es