Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000016409 (Nkap)
Chromosomal location
Chr X: 34666811 - 34690741 (+)
Description
NFKB activating protein Gene [Source:MGI (curated);Acc:Nkap-001]
RefSeq_dna
NM_025937 
RefSeq_peptide
NP_080213.2 
UniGene
Mm.55422 Mm.407869 
MGI
MGI:1914300 
Uniprot/SWISSPROT
Q9D0F4 
Uniprot/SPTREMBL
B1APM8 
Human Ortholog
ENSG00000101882 (NKAP)
Omim not available
UniTrap UNI22776
Vector Insertion
Chr X: 34667371 - 34670972
Public Clones not available
Private Clones OST285144 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000016553
Sequence
GGGGTTTACCGCTGTACACGGAACTGTTTCCAAGTTGGTTTTTTTGTTTGTTTGTTTGTTTGCTTGCTTTTTTTCGGATTTGGTCGGCTGCAAGCTCTAG

GACCCTAGGTGTCCGGGACCTTTGGGGGTCGCGAGAGCGCCTCCTTGTCCCGCCCCTTGGTAGCTTCAGCTTCCCCCACCATGGCTCCTGTATCGGGCTC

GCGTAGCCCTGAACGGGAGGCCTCCGGGGCGAAGCGTCGCAGTCCATCGCGGAGCCCCAAATCCATCAAATCTTCCCGCTCCCCGCGGTGTCGCCGGTCT

CGCTCGCGCTCTTGTTCTCGGTTCGGCGACCGGAATGGCCTCAGTCATTCGCTGAGTGGCTTCAGCCAAAGCTCCCGAAACCAATCTTACCGCTCCCGCT

CTCGATCGCGCTCTCGCGAACGGCCCTCGGCACAGCGGAGCGCCCCGTTTGCTTCTGCATCCTCGTCCGCCTATTACGGCGGCTACTCGCGTCCCTACGG

GGGCGACAAGCCATGGCCTAGCCTGCTGGACAAGGAAAGGGAGGAGAGTCTCCGGCAGAA - UNI22776 - GAGATTAAGTGAAAGAGAGAGGATTG

GAGAATTGGGAGCTCCTGAAGTTTGGGGACTTTCCCCAAAGAATCCTGAACCAGA CTCTGATGAACATACACCAGTAGAGGATGAAGAACCAAAGAAAA

GCACTACTTCAGCATCTAGTTCAGAAG ATGATAAGAAGAAGAAAAGGAAATCTAGTCATTCAAAAGACAGAGCCAAGAAAAAGAGAAAGAAAAAGTCAT

CTAAAAGAAAACATAAAAAGTATTCTGAAGATAGCGACAGTGACTCTGAATCTGACACAGACTCCAGCG ATGAAGATTCAAAAAGAAGAGCAAAGAAAG

CTAAGAAAAAGGACAAGAAAAAGAAACGAAGAGG GAAGAAATACAAGAAAAAGAAGTCTAAGAAAAACAGAAAAGAGTCCAGTGATTCGAGCTCTAAAG

AGTCCCAAGAAGAATTTCTAGAGAATCCTTGGAAGGATCGATCAA AGGCAGAAGAACCATCAGATTTGATTGGCCCAGAGGCTCCCAAAACTCTTGCCT

CCCAAGATGATAAGCCTTTGAA CTATGGCCACGCTCTGTTACCTGGTGAAGGCGCAGCTATGGCTGAATATGTAAAAGCTGGCAAGCGTATCCCAAGAA

GAGGTGAAATTGGCTTGACAAGTGAAGAGATCGCATCATTTGAATGTTCCGGTTACGTAATGAGTGGTAGCAG GCATCGCCGAATGGAGGCTGTTCGAC

TTCGGAAAGAGAACCAGATCTACAGTGCTGATGAGAAGAGAGCCCTTGCATCCTTTAACCAAGAAGAAAGACGAAAGAGGGAGAACAAGATTCTGGCCAG

CTTTCGTGAGATGGTATACAGAAAGACCAAAGGGAAGGATGACAAGTGAGGACTTCTTGGCTTTACAAGTGAATATTTTTAACATCGAAAAGGAAATTGT

GGGTTCTAACAACAAAAGCTTATTGTTTTGTTTTTGTTTTGAGTTACTGTTTGATGTATGGTTTCAATTAGCCCAGGTTGACCTCAGGCTTTGTAGCCAA

GGATGACTCTGAACTCTTGGTCTCCTGCCTCCACCTTCCAAGTGCTGAAATTCGAGGTGTGTGCCACCAGGCCCAGCCAAAAAGGCTACTGTGCTATGAA

GTGGCTTTTCAGGGCTTCTGTGCCTTCTTTTTAATTCTTCAGTCCTTCAATAAAAGATGCTTGTTGATAAAATTAGTTAAGTTATTTGAGGCTTTTAAAG

ATTGACCCCAGCCTTCTGGTTTAAAAGTCCAAAGTCCTGCTATGTTCGGAAGGTGGCATAGAGAGAAAGTGGCAGATGAACGAGAAGGTTAAGTCTCACA

TCATGATCTGGTGTGACTATGATTATTAGCCCCATACAGTGTCTGCCACTATCCCAGCAGAACTTGAGAATTTCATATCTTGTTTTGAATGTGTTACAGA

TGGGCTTGACAGAAACTATTTAGGAGGCTATTTCTGTTAACAAACTGACGGTGTTGCTGTGCACAGCCACTCTGGAATTGGAAAACTGGCTTGCCTCTAT

AGTCGGCCCTAGAAATGTATACTGGGCTAACTCTACCTCTGCTCTAAAACCAAGCAAACCAAATGGCTGACTCACACATGTGTGGGGCAGAAAATGTGAG

CATTAGCTGTTTCCCGTCCTATTACATTACTTACCATTGTTCTTTCAGTGGCTAGGATGTAGCTCAGAGTTAGAGCACGTGCTTATGAGGCCCCGAGCTA

CATCCCCAGCAGTGCAAAAAAGTTCCAAATGCAGTTTTGGGAGTCTATTGTGCCAATATAAGAATACTATTTCTATTTAAGCTGGTATTTAATAGAGGAT

AATATCTTAAAAATGAGTATTAAGAGTGCTAATAAGGGAAAATATAATAAGTCAGTATTTTAATTAAGCTGTTTCATGATGATGATGAAAGTAAAATATT

AAACATTTTCAATTATGTCCTTTATATTACCAGATTTCTTGTTTGAGACAGAGTCTCACTATGTAGCCCTGGATGGCCTAGAACTCCCAGAGTTCCCCCT

GCCTCAGCCTGCCAGGTGCTAGGATTAGAGGTGTGTGCCACTGCACCTCACTATAGGATTTTATTTTAAATATTGTTAAGCTCTTCAGCTTTTTATATCT

GTCATGACTTTAATCCTTAACTTTCTAGAAACCCTCCTTACTTCATTACTGTTTGAAAGTTTAATATATGTTCTGAGAAAATGTGTTTCTAACCCACAAC

TGCTGAACTAAGCAGCAGTTAGCATGTAGTAAAATCTGTGATCTTTGAACTTGAAATTATTTCATGGTATTTATACGTCTCAGTCTGATAAGTATATAGT

TTCCTAAAGTCTAATGGAAACTAGGTTCCAAAGTTGAAAGTCTTCTTAATCCATACACTTCCTCATGTAATACAATGTAAAGTTTATAATCGCTACTTTA

AAAGTTAAAACGAAGGGCCATTATTTTTTGTTAAATGGCTCCTAGCAACTGGGTGAATATGTTTTTCTTTTTTTTAATAGGAAATGTAGTTTCAATGCAA

CAATTTTGTAGTGTATAAGTATTACAGATTTTCTTTTGATTATTCTCCACAGAGTATATACAGTCAATGAAAAAATAGGAATTTATTTAAAAATCTATCA

TTATTTAGTAGCAGTCCTTTAAAAAATGGAGGGCTAAAAGTATTTTATTTTTAGCTTGTTTGAATTATCCCTTCAAACTGTGTTCTTTCACCTGAGCTCT

AAGTCAGCCATTGTTTGCAAAAACATATCTTTCCTTGTCTACAGAAGAAGAAACACACACTCGTGTACACACACACACACACACACACACACACACACAC

ACTTATAATTGAACAAAACATTAAGCCAGGAATTTCCTCTTTGTTACATTCCTAGTGAACAAGGTAGTGGTTATGCTTCTATCTGTTTTCTTTATAGCTC

TTTAGGCCTGAGTAAAGGCTATGTAGAAGTATTGTAATTTAAATATTTTGTTTTCTAAAGAGACTTACTCAGTTTCTCACCTCTTCGCCTGTTGTTTATA

GGATTTCTCTCTTTTTTTATTTGTTGTACAAAGATAATAGGAAAAATAGAGAAATTGCTCAGTCCTACCACATGAATTGTTACAAGTGTTCTGTGTCCCT

TGTACGTCTTTGTCATTTGAAGTGTACTGTAAAGTTGTCTTTGGTATTTTAAAATTGTGTGAGCAGGCATAGGAGTCCCATTGGGAAGTTAGGAATACAT

GATGATCCAGTGTGAAGACAGAAATAAGGAAGGGTGGTAACCCACCCCTGCTTCATTGCAATCATGAGCATGATGGGATGTTCAGAGTTTAGCAGTGAGG

TCATCTGACAGTAGAAGAGATCTATGGGTAGTGGAGCCCTTCAGACTGTTAGTGTGAGATATAGAACGGTTGCCAGTTTGTTATCCAGATACCCATAAAA

ATGTCTATCAAGCCTAGAGCTAGGCAGAGAGAAGGACCAGACAGCTAAGGGCCAGTGGCTGAACTTTAGTAATGTTCACAACTCGACTCTGTGCTTGCCA

CACTCCAAAATCTTCTCCAGAACAGAAAACAACTTATTGCAGAATGGATAATGAATAAAAACAAAAACACAGTTGGGTTGTGTGCCATGAGTTTATTACT

CAATAAATATTATGTGCTTTGACATGTTTC
Translation
MAPVSGSRSPEREASGAKRRSPSRSPKSIKSSRSPRCRRSRSRSCSRFGDRNGLSHSLSGFSQSSRNQSYRSRSRSRSRERPSAQRSAPFASASSSAYYG

GYSRPYGGDKPWPSLLDKEREESLRQK - UNI22776 - KRLSERERIGELGAPEVWGLSPKNPEPD DSDEHTPVEDEEPKKSTTSASSSED DDKK

KKRKSSHSKDRAKKKRKKKSSKRKHKKYSEDSDSDSESDTDSSD DEDSKRRAKKAKKKDKKKKRRG GKKYKKKKSKKNRKESSDSSSKESQEEFLENP

WKDRSK KAEEPSDLIGPEAPKTLASQDDKPLN NYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIASFECSGYVMSGSR RHRRMEAVRLRKEN

QIYSADEKRALASFNQEERRKRENKILASFREMVYRKTKGKDDK

For any suggestions or comments, please send an email to unitrap@crg.es