Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000016541 (Atxn10)
Chromosomal location
Chr 15: 85166810 - 85293639 (+)
Description
ataxin 10 Gene [Source:MGI Symbol;Acc:MGI:1859293]
RefSeq_dna
NM_016843 
RefSeq_peptide
NP_058539.2 
UniGene
Mm.248906 Mm.405017 Mm.452096 
MGI
MGI:1859293 
Uniprot/SWISSPROT
P28658 
Uniprot/SPTREMBL
Q3TCF4 Q3TKP3 Q8BWX1 
Human Ortholog
ENSG00000130638 (ATXN10)
Omim 603516 - SPINOCEREBELLAR ATAXIA 10  
UniTrap UNI12709
Vector Insertion
Chr 15: 85167011 - 85189883
Public Clones (sanger) F011B05 (ggtc)
Private Clones OST379687 (lexicon) OST326254 (lexicon) OST275484 (lexicon) OST237477 (lexicon)
OST136372 (lexicon) OST136286 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25411
Vector Insertion
Chr 15: 85190076 - 85195706
Public Clones not available
Private Clones OST184877 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1416
Vector Insertion
Chr 15: 85223937 - 85268531
Public Clones CH0431 (sanger) AL0476 (sanger) (sanger)
Private Clones OST334935 (lexicon) OST17535 (lexicon)
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29137
Vector Insertion
Chr 15: 85268596 - 85292709
Public Clones not available
Private Clones OST7489 (lexicon)
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000016685
Sequence
ATCTCCTCGCCTGTCGTCTGTCTCCCCCACTTCTCTTCGCTCTGCTCTCCGCCTGGTCAGGCTCGGCCCCAGAGCGAGTGGCAAGATGGCGGCGCCCAGG

ATGCCACCCTCCCGGCTGTCGGGCATCATGGTGCCCGCACCCATCCAGGACCTGGAGGCCTTGCGCGCGCTCACGGCGCTCTTCAAGGAGCAGCGTAACC

G - UNI12709 - GGAAACAGCACCCAGAACGATCTTCCAGAGAGTCCTGGATATCTTAAAGAAGTCTACTCATGCTGTTGAGCTGGCCTGCAGGGAT

CCCTCCCAAGTGGAACATCTGGCTTCCAGTCTGCAGCTAATCACTGAATGCTTCAGATGTCTTCGGAATGCTTGTATAGAGTGTTCTGTGAATCAGAATT

CCATCAG - UNI25411 - GAACCTGGATACGATCGGAGTTGCTGTTGATTTGGTTCTTCTCTTTCGTGAACTTCGGGTGGAACAAGACTCCTTGTTG

ACAG CTTTTCGATGTGGCCTGCAGTTTTTAGGCAACGTTGCCTCACGAAATGAAGAATCCCAGTCCATTGTTTGGGTCCACGCCTTCCCAGAACTCTTC

AT GTCTTGCTTGAACCATCCAGACAAAAAGATTGTTGCCTACTGTTCCATGATTCTGTTCACATCTCTTAATGCTGAAAGGATGAAAGACCTGGAAGAG

AACCTCAATATTGCAATTAACGTCATAGAAGCTCACCAAAAGCACCCGGCGTCAGAGTGGCC GTTCTTGATTATTTCAGACCACTTTCTGAAAAGCCCG

GAACTGGTGGAAGCTATGTATGGCAAACTCAGCAACCAGGAAAG GATCACACTGTTAGACATAGTGATAGCCAAGCTAGTGGGTGAGGAGCAGCTGACA

AAGGATGACATCTCTATCTTTGTGCGCCATGCCGAGTTGATTGCAAACTCATTTATGGATCAGTGCAGGAACGTGCTGAAGTTGACCTCAGAGCCTCACA

CCGAGGATAAG GAAGCCCTGGTTACGATTCGGCTCCTGGATGTCTTGTGTGAAATGACGTCCAACACTGAGCTTCTCGGCTACCTGCAGGTTTTCCCTG

GCCTGATGGAACGCGTGATTG ATGTTTTACGAGTGATTCATGAAGTTGGAAAAGAAAGCACGAACATCTTCAGTCCCTCAGACTCTCTAAAAGCAGAGG

GTGACATCGAACACATGACTGAAGGCTTTAAGTCTCATCTCATCCGTCTGATTGGAAATCTGTGCTACAAGAATAAAGAAAACCAAGACAAA - UNI14

16 - GTGAATGAGCTGGATGGCATTCCTCTGATCCTGGACAGCAGCAACATCGATGACAACAACCCCT - UNI29137 - TTATGATGCAGTGGGTG

GTGTATGCTGTGCGAAATCTCACTGAAGACAACAGCCAAAACCAAGATGTCATTGCCAAGATGGAGGAGCAGGGCTTGGCAGACGCATCCCTACTGAAGA

AAATGGGCTTTGAAATTGAAAAGAGTGGGGATAAACTGATTCTGAAGTCTAATAATGACATCCCCCCGCCT TGAATGCCATCTTCATATGAACACATTC

AGATTCCATCTCACGGACCTCTCATCTCTGCAGTGTATGAAATCACAAGTATTGGACATGTAGGGTACAGATGAGGGAGCCTCCTAATCCTTTAGAGTAA

ATGAGTGTAAGCTACAAGTGGACGTTTTCTTTATTTCTTTGCAGTAAGTGTTACTGTCTGCCTCACCTTTGTCCCTCTGGGTAGAACTCGCTTTCCCGTC

ATATACATTGTGCTTACTGTTGTAGTAATAAACGTCTCTGTGGGCACAGCCCTCACTCGGC
Translation
MAAPRMPPSRLSGIMVPAPIQDLEALRALTALFKEQRNR - UNI12709 - RETAPRTIFQRVLDILKKSTHAVELACRDPSQVEHLASSLQLITECF

RCLRNACIECSVNQNSIR - UNI25411 - RNLDTIGVAVDLVLLFRELRVEQDSLLTA AFRCGLQFLGNVASRNEESQSIVWVHAFPELFM MSCL

NHPDKKIVAYCSMILFTSLNAERMKDLEENLNIAINVIEAHQKHPASEWP PFLIISDHFLKSPELVEAMYGKLSNQER RITLLDIVIAKLVGEEQLTK

DDISIFVRHAELIANSFMDQCRNVLKLTSEPHTEDK EALVTIRLLDVLCEMTSNTELLGYLQVFPGLMERVID DVLRVIHEVGKESTNIFSPSDSLKA

EGDIEHMTEGFKSHLIRLIGNLCYKNKENQDK - UNI1416 - VNELDGIPLILDSSNIDDNNPF - UNI29137 - FMMQWVVYAVRNLTEDNSQ

NQDVIAKMEEQGLADASLLKKMGFEIEKSGDKLILKSNNDIPPP P

For any suggestions or comments, please send an email to unitrap@crg.es