Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000016559 (H3f3b)
Chromosomal location
Chr 11: 115883226 - 115889276 (-)
Description
H3 histone, family 3B Gene [Source:MGI (curated);Acc:H3f3b-001]
RefSeq_dna
NM_008211 
RefSeq_peptide
NP_001074488.1 NP_032237.1 NP_032236.1 
UniGene
Mm.371563 
MGI
MGI:1097686 MGI:1101768 
Uniprot/SWISSPROT
P84244 
Uniprot/SPTREMBL
A2A852 
Human Ortholog
not available
Omim not available
UniTrap UNI34250
Vector Insertion
Chr 11: 115886618 - 115889277
Public Clones IST10497F3 (tigm) IST14516C9 (tigm) IST12320G6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1988
Vector Insertion
Chr 11: 115885334 - 115885692
Public Clones BC0209 (sanger) (ggtc)
Private Clones OST265571 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17899
Vector Insertion
Chr 11: 115884850 - 115884938
Public Clones not available
Private Clones OST434015 (lexicon) OST315063 (lexicon)
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000016703
Sequence
GCAGAGCGGTTTGGTCGTTCGTTGGTGGAGTATCTGCCCGTTCTGCTCGCCGATTGCGGCTCTTGTTCGAGCGCTTCCAGCGTCGCCTCGGTCTCAGCAA

GGGCCCCAGACTCGGCTTTGG - UNI1988 - GTGAAAAAAAATGGCCCGAACCAAGCAGACCGCTAGGAAGTCCACCGGTGGGAAAGCCCCCCGCAA

ACAGCTGGCCACCAAGGCGGCTCGGAAAAGCGCGCCCTCTACCGGCGGGGTGAAGAAGCCTCACCGCTACAG GCCAGGGACCGTGGCTCTGAGAGAGAT

CCGTCGTTACCAGAAATCGACTGAGCTGCTCATCCGGAAGCTGCCATTCCAGAGATTGGTGAGGGAGATCGCCCAGGATTTCAAAACCGACTTGAGGTTT

CAAAGTGCAGCCATCGGTGCCCTTCAG - UNI17899 - GAGGCTAGCGAAGCATACCTGGTGGGGTTGTTTGAAGATACCAATCTGTGTGCCATCCA

CGCCAAGAGAGTCACCATCATGCCCAAAGACATCCAGTTGGCTCGCCGGATACGGGGGGAGAGAGCTTAAGTTGAAGCGGTTTTTATGGCATTTTGTAGT

AAATTCTGTAAAATACTTTGGTTTAATTTGTGACTTTTTTTGTAAGAAATTGTTTATAATATGTTGCATTTGTACTTAAGTCATTCCATCTTTCACTCAG

GATGAATGGGAAGAGTGACTGACTGTTCACAGACCTCAGTGATGTGAGCACTGTGGCTCAGGAGTGACAAGTTGCTAATACGCAGAAGGGATGGGTGATA

CTTCTTGCTTTTCATGATGCATGTTTCTGTATGTTAATGACTTGTTGGGTAGCTATTAAGGTACTAGAATTGATAAATGTGTACAGGGTCCTTTTGCAAT

AAAACTGGTTATGACTTGATCCAAGTGTTTAACCATACATCACTGTGATAGAATGTGGGCTTTTTCAAAGGTTGAAGATACAAGTTTTAGCCACAGTGTA

ACAGTTTCCTTTAAAAAAAAAAAAGTAAACCTGGCAGCTATAGAATACACTATGTGCATTTATAATAGCTATTTTATATATTGTAGTGTTCAACATTTTT

AAATTAAATGTTTTACATTCACAAGTGGTGGGGAGTCTTGTCATTAAGGTGTGTGTAATTTAGTCCAGTTGGTATTTCCTGACTAGACTGCATTTGTTTT

TAACAGTAGAAAAATGCTATGCGTATTAAACCTTGCATAAGTCCTCATTCTACCACATGTTCACTAACCCCTGACCCTCTGGCTGGTAACACAACACTAA

CGGGGATTTTATTTATAAGGGCTCTAGAGTAAAATAACAAGCTATTCACACCAGCATCATCTATTACTAATCTAGTTAGTGCAGCTTTTCATTGTGTTTG

GTCTTAGGCCTAGATTGAGTTCGGTTTCGTTTCTTTTTAATCTTTAAGGGGGAAAACTGTACAAGGTTTGTTTTTCCTTGTAGAGTTTATAAACATGGGA

GTAAGAACACAGCTTCAACTTCTTGGACCTCTGCCAATGAAGATGGGTTAGGTTACACCTGGTTACTATACTGGCAAAATCCCTTTTATAGAGATGGCCT

TCAAGTGGTTTTTAAAAGTATCCTATTGAAGTTTTTAGGTCAATTATGTATGTTGACTAAATTTACAAATAAACTTGTTTATTC
Translation
 - UNI1988 - MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYR RPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRF

QSAAIGALQ - UNI17899 - EASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Transcript ENSMUST00000106454
Sequence
GGACCAGGGACAGGACAGGAACAGAACAACAGTCCCGATGCTGCTGAGCTGCTCTGACTGCAGCAGTGCCTTGGGATCAAGCCCAGGGCTTCACCTCACC

CCCTCAG - UNI34250 - ACTGGCCTTGACTTAAGTAGCTGTGAATGACCTTGAATTTTGGATCCTGATTCCATCTCTGATATTACCTTCATGCACC

TGGAGCTTGGTTTATGTAGTCCTGGAGAAAAAACAAACAAACCAGGATTTATAAAAGACAAGATCTCTGTAG - UNI34250 - CCAATCCTGAAGCA

ATTGTAACAGCCAATCAGTGGCCTGAACACCGGCCAATCAGGAAACGGCCCCGAAGTACGGCCTTTGTGTCGGGAGATGTCAGCGCGTCGGCGAAAGCTC

CCGCCAATCGAAAAAGTCGTTGGTGTATGCAAATCAGGGTTCTGTGACGCACTGACGCAGCGTGCAGCGTCTCTATAAATATGGAGGCGTCGGGGGGCTT

GGAGCGCAGAGCGGTTTGGTCGTTCGTTGGTGGAGTATCTGCCCGTTCTGCTCGCCGATTGCGGCTCTTGTTCGAGCGCTTCCAGCGTCGCCTCGGTCTC

AGCAAGGGCCCCAGACTCGGCTTTGG - UNI1988 - GTGAAAAAAAATGGCCCGAACCAAGCAGACCGCTAGGAAGTCCACCGGTGGGAAAGCCCCC

CGCAAACAGCTGGCCACCAAGGCGGCTCGGAAAAGCGCGCCCTCTACCGGCGGGGTGAAGAAGCCTCACCGCTACAG GCCAGGGACCGTGGCTCTGAGA

GAGATCCGTCGTTACCAGAAATCGACTGAGCTGCTCATCCGGAAGCTGCCATTCCAGAGATTGGTGAGGGAGATCGCCCAGGATTTCAAAACCGACTTGA

GGTTTCAAAGTGCAGCCATCGGTGCCCTTCAG - UNI17899 - GAGGCTAGCGAAGCATACCTGGTGGGGTTGTTTGAAGATACCAATCTGTGTGCC

ATCCACGCCAAGAGAGTCACCATCATGCCCAAAGACATCCAGTTGGCTCGCCGGATACGGGGGGAGAGAGCTTAAGTTGAAGCGGTTTTTATGGCATTTT

GTAGTAAATTCTGTAAAATACTTTGGTTTAATTTGTGACTTTTTTTGTAAGAAATTGTTTATAATATGTTGCATTTGTACTTAAGTCATTCCATCTTTCA

CTCAGGATGAATGGGAAGAGTGACTGACTGTTCACAGACCTCAGTGATGTGAGCACTGTGGCTCAGGAGTGACAAGTTGCTAATACGCAGAAGGGATGGG

TGATACTTCTTGCTTTTCATGATGCATGTTTCTGTATGTTAATGACTTGTTGGGTAGCTATTAAGGTACTAGAATTGATAAATGTGTACAGGGTCCTTTT

GCAATAAAACTGGTTATGACTTGATCCAAGTGTTTAACCATACATCACTGTGATAGAATGTGGGCTTTTTCAAAGGTTGAAGATACAAGTTTTAGCCACA

GTGTAACAGTTTCCTTTAAAAAAAAAAAAGTAAACCTGGCAGCTATAGAATACACTATGTGCATTTATAATAGCTATTTTATATATTGTAGTGTTCAACA

TTTTTAAATTAAATGTTTTACATTCACAAGTGGTGGGGAGTCTTGTCATTAAGGTGTGTGTAATTTAGTCCAGTTGGTATTTCCTGACTAGACTGCATTT

GTTTTTAACAGTAGAAAAATGCTATGCGTATTAAACCTTGCATAAGTCCTCATTCTACCACATGTTCACTAACCCCTGACCCTCTGGCTGGTAACACAAC

ACTAACGGGGATTTTATTTATAAGGGCTCTAGAGTAAAATAACAAGCTATTCACACCAGCATCATCTATTACTAATCTAGTTAGTGCAGCTTTTCATTGT

GTTTGGTCTTAGGCCTAGATTGAGTTCGGTTTCGTTTCTTTTTAATCTTTAAGGGGGAAAACTGTACAAGGTTTGTTTTTCCTTGTAGAGTTTATAAACA

TGGGAGTAAGAACACAGCTTCAACTTCTTGGACCTCTGCCAATGAAGATGGGTTAGGTTACACCTGGTTACTATACTGGCAAAATCCCTTTTATAGAGAT

GGCCTTCAAGTGGTTTTTAAAAGTATCCTATTGAAGTTTTTAGGTCAATTATGTATGTTGACTAAATTTACAAATAAACTTGTTTATTCAACTAAGTGTC

AAACCTAAATTGAATATACAAAGCTTTTAATACATATGGAATCGAGATTCCTAGATTCAGCTATTTGCTTGGTAGAAAAGGCTAAAGTACAGAAAGCATT

TGAACATCCAATACACTCTAAAAATGCAAGTATTTGCTGACACAATTCATGAGTCTGACAAAATCTGCTTGTGGTTCATGGGTGGGCTTAATAACTACAA

TACATGTTTGTTCCCATGGTTTTAGAATATTTGAAATTTTAAGTTTGCTGTTTTGGATCTTTCTAATAGGCCTTACAAATAAACTAGTAAGTTTGGAGTT

TTTTTCCTGGGGAAACAGTTTCTCTGTAGCCTTGGCCACAACTCCCACTGTAGAGCAGCAGGTTGGCTTC
Translation
 - UNI34250 -  - UNI34250 -  - UNI1988 - MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYR RPGTVALREIRRYQK

STELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQ - UNI17899 - EASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

For any suggestions or comments, please send an email to unitrap@crg.es