Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000016624 (Phf21b)
Chromosomal location
Chr 15: 84615814 - 84686479 (-)
Description
PHD finger protein 21B Gene [Source:MGI Symbol;Acc:MGI:2443812]
RefSeq_dna
NM_001081166 
RefSeq_peptide
NP_001074635.1 
MGI
MGI:2443812 
Uniprot/SWISSPROT
Q8C966 
Uniprot/SPTREMBL
B2RXP2 Q6NXL0 
Human Ortholog
ENSG00000056487 (PHF21B)
Omim not available
UniTrap UNI1743
Vector Insertion
Chr 15: 84638589 - 84685168
Public Clones CF0549 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9249
Vector Insertion
Chr 15: 84624349 - 84625509
Public Clones XG075 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000016768
Sequence
CTCGCACCCGCACCCCGGCCTGCAAACTTGCACGGCTCGGGGCGCGCCGCCGGGTGGCCTCGGCCCCCGCCCCGCCCCGGGAGCTGCCCCAATGAGGCGG

CAGCCACAG AACGGCGACCTCAAGAAGCAGCTCCACGAAAGGCAGCCACGGATCGCAGCGCTCAGCGACAAACAA - UNI1743 - GCTTTGGGATC

CACCACTGCAGTGCCTGTCACAGGTCCTCAGGTCAGCTCCCTGCAGAGGTTGGCTGGGCAAGGAGCAGCAGTGCTACCTCAG GTTAGGCCAAAGACTCT

GATTCCAGACAGCCTCCCTGTCACCCCGGGCAGGGACCGGCCACCCAAGCAACCCCCAACATTCCAAAAGGCCACTGTGGTCAGCATCAAGAACCCCAGC

CCAGCCCTCCCCACTGCCAACAACACCGTCAACCATGTGCCAACACCCAGCAGCCAGACCCAGGCCCTCACCGAGCCCACCGCCATCACCTCACCCCTGA

GCAGTGCCGGGGTGGCCTATGCCATCATCTCCACCTCCCCCAGCAATGCTGCCACCATCACCCCCAGCACCACTGTGCCCGTGGCCAGCGACGGCATCAA

AGTGCAGCCCCTCCTCATCAGTGCTGACAAAAAG GTTATCATCATTCAGCCACAAGTGAAGACACAGCCAGAGAGTTCAGCAGAGCCCGAGCCACCCAC

GGAGGAGCCATCTCAGGGAGCTCAGGCCACCAAGGAAGATCAGCCCCCCAGCAAGGAGAATCCTGAG AAAATCGCCTTCATGGTAGCTCTAGGCCTGGT

CACAACGGAACACCTAGAAG AGATCCAGAGCAAGCGGCAGGAGCGGAAGCGGAGGAGCACAGCCAACCCTGCCTATAGCGGCTTCTTGGAGACCGAG A

GGAAGCGGCTGGCCTCCAGTTATCTCCACAACCCCTTGTTCCTCACAGCACGAG - UNI9249 - CCAATGAGGACCCCTGCTGGAAG GGTGAAATC

ACCCATGATGAATTCTGTGCTGCCTGCAAGCGAGGAGCCAGCCTGCAACCCTGCGGCACCTGTTCAGGGGCCTACCACCTCAGCTGCCTGGACCCGCCCC

TTAAGACGCCACCCAAGGGCCTGTGGGTCTGCCCCAAGTGCCAGCGGAAG GCCTTAAAGAAAGATGAGGGTGTGCCCTGGACTGGGATGCTGGCCATTG

TACATTCCTATGTCACCCACAAGACAG TGAAAGAAGAGGAGAAGCAGAAATTGTTGCAGCGTGGCAGTGAACTGCAGTCTGAGCACCAGCAGCTAGAGG

AGCGGGACCGGCAGCTGGCCTCAGCTGTGAAG AAATGCTTGGAGCTGAAGACAAGCCTCCTGGCCCGCCAACGGGGCACACAGTCATCGCTGGACCGCA

TCCGGGCCCTCCTCAGACTGATCCAGGGTGAGCAGATGCTTCAGGTCGCTATGGCAACCACCAGCCCCACCCCACTTCTGGCCGGGCCCTGGACCAAGCC

TTCCACCACCACCACCATGCGCACTACCCTCCAGCACCCCCAGAATCACAACTGACCCCAGGGACCTGTCTAACACTCATGGAAAGTTACTGGGACCTTG

CTCTCAAGACCTGGAGGATCTGTCGGCCTTAATTCATAAACTCTATGAATTTTAGACAAAAATAAAACTAGAGAGTGATGAGAGAAAGGAGGAGTGAGAT

GAGTGTCCTAGAGCCAGAACCAGCCTGAGGTGGACCCCTCCACCAGTTGCAGGGTACACCCGGAGGCCAGGTGAAGGTGTCTCAGATCCAGGCACACTAG

GCCCACGAGGCTGCCAGACCTCCCTGGCCTTTGGGTTTCATGACCAGCTCTCTCCTTGCGTTGTCCCCCTCAAGACAGGAAGACTTTAGACTTTGGAGAG

TGAGGCAGACTGGGCCACACACCGCTTGTGAGGACTCAAGCTGACAACAGGTAGCTGGTTAGTGGGGGTGGGCGGGGTGGGCCTCTGGTGCAAGAGAGGG

TAGTTAACCTAGGTGGTTCTCCAGTGGCCCTGGGGCTTCCTGTGCCCCGCTGGCCCCTAATCCATCAGTATTACCATGTTGAAAATCAGTCATTTAACTG

GACAAGTGACAGGCCAGCTTCTCTTGGGGTCACCCACTGCTGCATGGGCTGCCTGGCCTGGCCTGGCCTCTGCCTCTCCTTTTCCCAGCTCACGCTCTTG

TTGCTGCCCACCCACCTCTTCCTATTGCCAATCCCTGGAATTTTCCTCATGGAGTTCAGGGCTAAAGGGAGCAGTCACCCAGCAGGGGAGGCACCTGGCA

GGTTTCAACTCAAAACCGGAAACCTTTCGAGCACTCTCCTTTGCAGGAGCCGCCAAGCATCCTGCCCACTTCATGCCAGTTAAAGACACTATGCCAAAAA

GAGCTTCACACTTTTTGTATAGCGTTTTGTTTTTGTTGTATGATCCGTAATGTGAACTGTGCCCCTGCCTGCCTTCCTCTGCATCTGATGGTCTCTGCTC

CGATACAGGAACTGGTAACCTCGCCTGAGAGGGACCAGATGGAGCACCCAAGAAGGGACTTAGAGATCCAGGGAGAAGGCAGAGAGAGTGGTGCACTTGG

GGCCCTGGCCTTGGGAGACTCCAGAGCCCTCAACGCTCTCCTCAAAGCGATCTCCATATTTGCAGGGAGTGTAGGCTCCTAGGCACCCTGGGGGCTCCTG

CACCTCTGTGAGCCATGTAGCCCACTTCCGCAAGCCTCACCCTGTCCCGAGGGACACAGCACAACCCATATGTGACCAGGAGCCACAGGGCTCCCCCCAC

CCCCGAGCATATCACACGGTGCCGAATTGCAGTGAGCACGCACGCGTGCATGCGCCAGGGCCACAGACGCACACCTGTGCACACAGACACAGGTGCAGAG

CGGGAAGGCTGACTGGGATCCCGCCACCAGCTGTTTTCCCTCTTGTCATTTCTCACGACTCCGGGAGAAACTGTGCTGTAGGATACAAATCTATTTTAAT

ACACATTACACTGGGTTGAACAAGATTTTTTATATTCTTTTATTGATGAACAACGTGGGCCCTGCGAGGCACACGCCTTTATATATTGGTTACGCGGTGC

CGATTATGCGTTACCGCACGGCTGGCGACGTAACTGTCTTCAGGTTCTTTTGTTGGTTTGATTTTTCTTCCTGGATGGATTGAGTTCGATTTTGCAAGAA

ACGTGGGAGGATGTTGGAAGGTTGGACCCGGGAGGGGGAGCTGCTGACGCGTCTCGAGACTTAGTTTTGATTTTTTTTTTCTTTTCTTTTCTTTTTTGGG

ACCAAGGGGGACCGTCCAGTGGATAGTGGCTAGAGAAAGTGTTTGTCTTAAATATTCCAGTGTAGTTTTCCTTCTGTATGATGCATTAAATCCAATTTC
Translation
SHPHPGLQTCTARGAPPGGLGPRPAPGAAPMRRQPQ NGDLKKQLHERQPRIAALSDKQ - UNI1743 - ALGSTTAVPVTGPQVSSLQRLAGQGAAV

LPQ VRPKTLIPDSLPVTPGRDRPPKQPPTFQKATVVSIKNPSPALPTANNTVNHVPTPSSQTQALTEPTAITSPLSSAGVAYAIISTSPSNAATITPST

TVPVASDGIKVQPLLISADKK VIIIQPQVKTQPESSAEPEPPTEEPSQGAQATKEDQPPSKENPE KIAFMVALGLVTTEHLEE EIQSKRQERKRRST

ANPAYSGFLETE RKRLASSYLHNPLFLTARA - UNI9249 - ANEDPCWK GEITHDEFCAACKRGASLQPCGTCSGAYHLSCLDPPLKTPPKGLWV

CPKCQRK ALKKDEGVPWTGMLAIVHSYVTHKTV VKEEEKQKLLQRGSELQSEHQQLEERDRQLASAVK KCLELKTSLLARQRGTQSSLDRIRALLRL

IQGEQMLQVAMATTSPTPLLAGPWTKPSTTTTMRTTLQHPQNHN
Transcript ENSMUST00000089001
Sequence
AGTCCCTGCCGGCGGTCAGCTGGCGCGGGCGGCGACAGGGCGCGCGCTGGGGGGCTGCGCGGGGCTCCCGGCGCCTGGGGGCCATGCGCCGGGCGGCGCA

GGCAGCCCGGGCACCCGGCGCAACTTAGCGGCAGCCGGAAGAGTTGGGCGCCAGCTCGCCTTTCTTCCCTCTCGTCAGCCTCCTTTCCTATCGGCGCTGC

AGGAGGGAACTCGTGTCTCTCTGTGCCCGGGACACCGGATCCGAGCTCTCCCGGTCTGGTTCCCGCCGAGCCGCACAACTTCCTGCGAGCTCCGGCCAAA

GTGAGCGCAAAGTGCTGCCCAAGTTGCGGCGATGGAGCTGCAAAGCCGGTCCGAGGCGCTCGCGGTGGAACTCGCGCGCCACCAG AACGGCGACCTCAA

GAAGCAGCTCCACGAAAGGCAGCCACGGATCGCAGCGCTCAGCGACAAACAA - UNI1743 - GCTTTGGGATCCACCACTGCAGTGCCTGTCACAGG

TCCTCAGGTCAGCTCCCTGCAGAGGTTGGCTGGGCAAGGAGCAGCAGTGCTACCTCAG GTTAGGCCAAAGACTCTGATTCCAGACAGCCTCCCTGTCAC

CCCGGGCAGGGACCGGCCACCCAAGCAACCCCCAACATTCCAAAAGGCCACTGTGGTCAGCATCAAGAACCCCAGCCCAGCCCTCCCCACTGCCAACAAC

ACCGTCAACCATGTGCCAACACCCAGCAGCCAGACCCAGGCCCTCACCGAGCCCACCGCCATCACCTCACCCCTGAGCAGTGCCGGGGTGGCCTATGCCA

TCATCTCCACCTCCCCCAGCAATGCTGCCACCATCACCCCCAGCACCACTGTGCCCGTGGCCAGCGACGGCATCAAAGTGCAGCCCCTCCTCATCAGTGC

TGACAAAAAGGTGAGT GCCTCCTTGCTTTGTAACCCTGGCCATCTCTCACATAGATGCTCTC TTACCTGGTTCCTCTGTGACACCCCTTTCAGGACCT

ACCTAACTCCTAGCTACTCCCTGCCCCTCCCTCCCTGGTTCTCTCATCTTCCCTGTGTCTTCCAGGTTATCATCATTCAGCCACAAGTGAAGACACAGCC

AGAGAGTTCAGCAGAGCCCGAGCCACCCACGGAGGAGCCATCTCAGGGAGCTCAGGCCACCAAGGAAGATCAGCCCCCCAGCAAGGAGAATCCTGAG AA

AATCGCCTTCATGGTAGCTCTAGGCCTGGTCACAACGGAACACCTAGAAG AGATCCAGAGCAAGCGGCAGGAGCGGAAGCGGAGGAGCACAGCCAACCC

TGCCTATAGCGGCTTCTTGGAGACCGAG AGGAAGCGGCTGGCCTCCAGTTATCTCCACAACCCCTTGTTCCTCACAGCACGAG - UNI9249 - CCA

ATGAGGACCCCTGCTGGAAG GGTGAAATCACCCATGATGAATTCTGTGCTGCCTGCAAGCGAGGAGCCAGCCTGCAACCCTGCGGCACCTGTTCAGGGG

CCTACCACCTCAGCTGCCTGGACCCGCCCCTTAAGACGCCACCCAAGGGCCTGTGGGTCTGCCCCAAGTGCCAGCGGAAG GCCTTAAAGAAAGATGAGG

GTGTGCCCTGGACTGGGATGCTGGCCATTGTACATTCCTATGTCACCCACAAGACAG TGAAAGAAGAGGAGAAGCAGAAATTGTTGCAGCGTGGCAGTG

AACTGCAGTCTGAGCACCAGCAGCTAGAGGAGCGGGACCGGCAGCTGGCCTCAGCTGTGAAG AAATGCTTGGAGCTGAAGACAAGCCTCCTGGCCCGCC

AACGGGGCACACAGTCATCGCTGGACCGCATCCGGGCCCTCCTCAGACTGATCCAGGGTGAGCAGATGCTTCAGGTCGCTATGGCAACCACCAGCCCCAC

CCCACTTCTGGCCGGGCCCTGGACCAAGCCTTCCACCACCACCACCATGCGCACTACCCTCCAGCACCCCCAGAATCACAACTGACCCCAGGGACCTGTC

TAACACTCATGGAAAGTTACTGGGACCTTGCTCTCAAGACCTGGAGGATCTGTCGGCCTTAATTCATAAACTCTATGAATTTTAGACAAAAATAAAACTA

GAGAGTGATGAGAGAAAGGAGGAGTGAGATGAGTGTCCTAGAGCCAGAACCAGCCTGAGGTGGACCCCTCCACCAGTTGCAGGGTACACCCGGAGGCCAG

GTGAAGGTGTCTCAGATCCAGGCACACTAGGCCCACGAGGCTGCCAGACCTCCCTGGCCTTTGGGTTTCATGACCAGCTCTCTCCTTGCGTTGTCCCCCT

CAAGACAGGAAGACTTTAGACTTTGGAGAGTGAGGCAGACTGGGCCACACACCGCTTGTGAGGACTCAAGCTGACAACAGGTAGCTGGTTAGTGGGGGTG

GGCGGGGTGGGCCTCTGGTGCAAGAGAGGGTAGTTAACCTAGGTGGTTCTCCAGTGGCCCTGGGGCTTCCTGTGCCCCGCTGGCCCCTAATCCATCAGTA

TTACCATGTTGAAAATCAGTCATTTAACTGGACAAGTGACAGGCCAGCTTCTCTTGGGGTCACCCACTGCTGCATGGGCTGCCTGGCCTGGCCTGGCCTC

TGCCTCTCCTTTTCCCAGCTCACGCTCTTGTTGCTGCCCACCCACCTCTTCCTATTGCCAATCCCTGGAATTTTCCTCATGGAGTTCAGGGCTAAAGGGA

GCAGTCACCCAGCAGGGGAGGCACCTGGCAGGTTTCAACTCAAAACCGGAAACCTTTCGAGCACTCTCCTTTGCAGGAGCCGCCAAGCATCCTGCCCACT

TCATGCCAGTTAAAGACACTATGCCAAAAAGAGCTTCACACTTTTTGTATAGCGTTTTGTTTTTGTTGTATGATCCGTAATGTGAACTGTGCCCCTGCCT

GCCTTCCTCTGCATCTGATGGTCTCTGCTCCGATACAGGAACTGGTAACCTCGCCTGAGAGGGACCAGATGGAGCACCCAAGAAGGGACTTAGAGATCCA

GGGAGAAGGCAGAGAGAGTGGTGCACTTGGGGCCCTGGCCTTGGGAGACTCCAGAGCCCTCAACGCTCTCCTCAAAGCGATCTCCATATTTGCAGGGAGT

GTAGGCTCCTAGGCACCCTGGGGGCTCCTGCACCTCTGTGAGCCATGTAGCCCACTTCCGCAAGCCTCACCCTGTCCCGAGGGACACAGCACAACCCATA

TGTGACCAGGAGCCACAGGGCTCCCCCCACCCCCGAGCATATCACACGGTGCCGAATTGCAGTGAGCACGCACGCGTGCATGCGCCAGGGCCACAGACGC

ACACCTGTGCACACAGACACAGGTGCAGAGCGGGAAGGCTGACTGGGATCCCGCCACCAGCTGTTTTCCCTCTTGTCATTTCTCACGACTCCGGGAGAAA

CTGTGCTGTAGGATACAAATCTATTTTAATACACATTACACTGGGTTGAACAAGATTTTTTATATTCTTTTATTGATGAACAACGTGGGCCCTGCGAGGC

ACACGCCTTTATATATTGGTTACGCGGTGCCGATTATGCGTTACCGCACGGCTGGCGACGTAACTGTCTTCAGGTTCTTTTGTTGGTTTGATTTTTCTTC

CTGGATGGATTGAGTTCGATTTTGCAAGAAACGTGGGAGGATGTTGGAAGGTTGGACCCGGGAGGGGGAGCTGCTGACGCGTCTCGAGACTTAGTTTTGA

TTTTTTTTTTCTTTTCTTTTCTTTTTTGGGACCAAGGGGGACCGTCCAGTGGATAGTGGCTAGAGAAAGTGTTTGTCTTAAATATTCCAGTGTAGTTTTC

CTTCTGTATGATGCATTAAATCCAATTTC
Translation
MELQSRSEALAVELARHQ NGDLKKQLHERQPRIAALSDKQ - UNI1743 - ALGSTTAVPVTGPQVSSLQRLAGQGAAVLPQ VRPKTLIPDSLPVT

PGRDRPPKQPPTFQKATVVSIKNPSPALPTANNTVNHVPTPSSQTQALTEPTAITSPLSSAGVAYAIISTSPSNAATITPSTTVPVASDGIKVQPLLISA

DKKVS ASLLCNPGHLSHRCSL LTWFLCDTPFRTYLTPSYSLPLPPWFSHLPCVFQVIIIQPQVKTQPESSAEPEPPTEEPSQGAQATKEDQPPSKENP

E KIAFMVALGLVTTEHLEE EIQSKRQERKRRSTANPAYSGFLETE RKRLASSYLHNPLFLTARA - UNI9249 - ANEDPCWK GEITHDEFCAA

CKRGASLQPCGTCSGAYHLSCLDPPLKTPPKGLWVCPKCQRK ALKKDEGVPWTGMLAIVHSYVTHKTV VKEEEKQKLLQRGSELQSEHQQLEERDRQL

ASAVK KCLELKTSLLARQRGTQSSLDRIRALLRLIQGEQMLQVAMATTSPTPLLAGPWTKPSTTTTMRTTLQHPQNHN

For any suggestions or comments, please send an email to unitrap@crg.es