Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000016833 (Mrps18c)
Chromosomal location
Chr 5: 101227756 - 101233490 (+)
Description
mitochondrial ribosomal protein S18C Gene [Source:MGI (curated);Acc:Mrps18c-002]
RefSeq_dna
NM_026826 
RefSeq_peptide
NP_081102.1 
MGI
MGI:1915985 
Uniprot/SWISSPROT
Q8R2L5 
Uniprot/SPTREMBL
Q8BTZ9 
Human Ortholog
ENSG00000163319 (MRPS18C)
Omim not available
UniTrap UNI18069
Vector Insertion
Chr 5: 101227880 - 101228570
Public Clones IST10881E7 (tigm) IST11945H12HMF2 (tigm)
Private Clones OST430955 (lexicon) OST324590 (lexicon) OST60289 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29009
Vector Insertion
Chr 5: 101232130 - 101232988
Public Clones not available
Private Clones OST13061 (lexicon)
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112898
Sequence
GGAAATAGAAAGGAAGAGGAAGGGCGGAGAACCATGGCCGCTCTGGTTGCTCTGTGCAGTGGTATAGGGAGGAAGAATTTGACAACCGCGGCTGGCTGCT

TCACGGATCGCGGAACTCAAGCAG - UNI18069 - TTTCTGTGATTTGGAGACGATGTTTTTCACAGTTTGAACAGGTAACCAGCAATGAGGACCTG

 CCAGTCCCAATGGAGAACCCCTACAAGGAGCCTCTTAAGAAGTGTGTCTTGTGTGAGAAACGTGTAGATTACAAGAATGTGCAG - UNI29009 - G

TCTTTGTGGAAAGAAACAGAGGGAAATAACTAAAGCCATTAAGAGAGCTCAGAAAATGG GGTTTATGCCAGTTACATACAAGGATCCTGCATATCTCAA

AGACCCTAGAGTTTGTAACATCAGATACCGAGAATAAATTTTGTATTTGTGAAGTTCCTGCCAATAAACCTCTAAGTGGTTGTCAGCAGA
Translation
MAALVALCSGIGRKNLTTAAGCFTDRGTQAV - UNI18069 - VSVIWRRCFSQFEQVTSNEDL PVPMENPYKEPLKKCVLCEKRVDYKNVQ - UN

I29009 - VFVERNRGK 
Transcript ENSMUST00000112901
Sequence
AGGAAGAGGAAGGGCGGAGAACCATGGCCGCTCTGGTTGCTCTGTGCAGTGGTATAGGGAGGAAGAATTTGACAACCGCGGCTGGCTGCTTCACGGATCG

CGGAACTCAAGCAG - UNI18069 - TTTCTGTGATTTGGAGACGATGTTTTTCACAGTTTGAACAGGTAACCAGCAATGAGGACCTG CCAGTCCCA

ATGGAGAACCCCTACAAGGAGCCTCTTAAGAAGTGTGTCTTGTGTGAGAAACGTGTAGATTACAAGAATGTGCAG CTTTTGTCCCAGTTTATTTCTCCA

TTTACCGGATGCATTTATGGAAGGCACATAACAG - UNI29009 - GTCTTTGTGGAAAGAAACAGAGGGAAATAACTAAAGCCATTAAGAGAGCTCA

GAAAATGGGTAAGCACTCCTGCACAGCTGAGTTGAACTAATTTAAGATTTTGCTCATTGTCTTTGTCAAGAACTTTAATTATCGTGTCTCTAGCTGCATA

TGAATCAAAAAATGGCCTAGTCGGCCATCAGTGGAAAGAGAGGCCCATTGGTCATGCAAAATTTATATGCCTCAGTACAGGGGAACGCCAGGGCCAAGAA

GTGGGAGTGGGTGGGTGGGGGAGCGTGTGGGGGACTTTTGGGATAGCATTGGAAATGTAAATGAAATACCCCCCCCTCCCAAAAAAAGAACTTTAATTAT

CTCTTTACAGGGTTTATGCCAGTTACATACAAGGATCCTGCATATCTCAAAGACCCTAGAGTTTGTAACATCAGATACCGAGAATAAATTTTGTATTTGT

GAAGTTCCTGCCAATAAACCTCTAAGTGGTTGTCAGCAGACTCCAACTAA
Translation
MAALVALCSGIGRKNLTTAAGCFTDRGTQAV - UNI18069 - VSVIWRRCFSQFEQVTSNEDL PVPMENPYKEPLKKCVLCEKRVDYKNVQ LLSQ

FISPFTGCIYGRHITG - UNI29009 - GLCGKKQREITKAIKRAQKMGKHSCTAELN
Transcript ENSMUST00000016977
Sequence
AGAAAGGAAGAGGAAGGGCGGAGAACCATGGCCGCTCTGGTTGCTCTGTGCAGTGGTATAGGGAGGAAGAATTTGACAACCGCGGCTGGCTGCTTCACGG

ATCGCGGAACTCAAGCAG - UNI18069 - TTTCTGTGATTTGGAGACGATGTTTTTCACAGTTTGAACAGGTAACCAGCAATGAGGACCTG CCAGT

CCCAATGGAGAACCCCTACAAGGAGCCTCTTAAGAAGTGTGTCTTGTGTGAGAAACGTGTAGATTACAAGAATGTGCAG CTTTTGTCCCAGTTTATTTC

TCCATTTACCGGATGCATTTATGGAAGGCACATAACAG - UNI29009 - GTCTTTGTGGAAAGAAACAGAGGGAAATAACTAAAGCCATTAAGAGAG

CTCAGAAAATGG GGTTTATGCCAGTTACATACAAGGATCCTGCATATCTCAAAGACCCTAGAGTTTGTAACATCAGATACCGAGAATAAATTTTGTATT

TGTGAAGTTCCTGCCAATAAACCTCTAAGTGGTTGTCAGC
Translation
MAALVALCSGIGRKNLTTAAGCFTDRGTQAV - UNI18069 - VSVIWRRCFSQFEQVTSNEDL PVPMENPYKEPLKKCVLCEKRVDYKNVQ LLSQ

FISPFTGCIYGRHITG - UNI29009 - GLCGKKQREITKAIKRAQKMG GFMPVTYKDPAYLKDPRVCNIRYRE

For any suggestions or comments, please send an email to unitrap@crg.es