Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000017146 (Brca1)
Chromosomal location
Chr 11: 101350078 - 101413126 (-)
Description
breast cancer 1 Gene [Source:MGI (curated);Acc:Brca1-001]
RefSeq_dna
NM_009764 
RefSeq_peptide
NP_033894.3 
UniGene
Mm.244975 
MGI
MGI:104537 
Uniprot/SWISSPROT
P48754 
Uniprot/SPTREMBL
A2A4Q4 B0FT00 Q3UMS5 Q6NV63 Q99LI1 Q9Z1D2 
Human Ortholog
ENSG00000012048 (BRCA1)
Omim 114480 - BREAST CANCER  
UniTrap UNI10712
Vector Insertion
Chr 11: 101410435 - 101413082
Public Clones (sanger) P025G05 (ggtc) E080C01 (ggtc) H004D01 (ggtc) M122A01 (ggtc)
IST10084G10 (tigm) IST10828G6 (tigm) IST10828G6BBF1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18590
Vector Insertion
Chr 11: 101410328 - 101410428
Public Clones CMHD-GT_505A2-3 (cmhd)
Private Clones OST420073 (lexicon) OST262846 (lexicon) OST202256 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10449
Vector Insertion
Chr 11: 101401349 - 101410328
Public Clones (sanger) D059H03 (ggtc) H001H11 (ggtc) E039F06 (ggtc) P026A01 (ggtc)
IST13793E3 (tigm)
Private Clones OST292029 (lexicon) OST37597 (lexicon) OST32564 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22607
Vector Insertion
Chr 11: 101395342 - 101396841
Public Clones not available
Private Clones OST290410 (lexicon) OST260489 (lexicon) OST68264 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5548
Vector Insertion
Chr 11: 101393474 - 101395252
Public Clones YTA154 (baygenomics) W027D03 (ggtc) A053D07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2041
Vector Insertion
Chr 11: 101392409 - 101393333
Public Clones AY0425 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6104
Vector Insertion
Chr 11: 101383817 - 101384638
Public Clones YHD247 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7042
Vector Insertion
Chr 11: 101371414 - 101374033
Public Clones RRY135 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3247
Vector Insertion
Chr 11: 101366719 - 101369263
Public Clones AK0476 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12098
Vector Insertion
Chr 11: 101363873 - 101366630
Public Clones A041A01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5315
Vector Insertion
Chr 11: 101363347 - 101363794
Public Clones SYA326 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18492
Vector Insertion
Chr 11: 101353569 - 101354865
Public Clones not available
Private Clones OST422545 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107228
Sequence
TTAAAAGTTCACTGGAACTGGAAGAAATGGATTTATCTGCCGTCCAAATTCAAGAAGTACAAAATGTCCTTCATGCTATGCAGAAAATCTTAGAGTGTCC

GATCTG - UNI10449 - - UNI18590 - TTTGGAACTGATCAAAGAACCTGTTTCCACAAAGTGTGACCACATATTTTGCAA ATTTTGTATGCT

GAAACTTCTTAACCAGAAGAAAGGGCCTTCACAATGTCCTTTGTGTAAGAATGAGATAACCAAAAG - UNI22607 - GAGCCTACAGGGAAGCACAA

GGTTTAGTCAGCTTGCTGAAGAGCTGCTGAGAATAATGGCTGCTTTTGAGCTTGACACGGGAATGCAGC - UNI5548 - TTACAAATGGTTTTAGTT

TTTCAAAAAAGAGAAATAATTCTTGTGAGCGTTTGAATGAGGAGGCGTCGATCATCCAGAGCGTGGGCTACCGGAACCGTGTCAGAAGGCTTCCCCAGGT

CGAACCTGGAAATGCCACCTTG - UNI2041 - AAGGACAGCCTAGGTGTCCAGCTGTCTAACCTTGGAATCGTGAGATCAGTGAAGAAAAACAGGCA

GACCCAACCTCGAAAGAAATCTGTCTACATTGAACTAG ACTCTGATTCTTCTGAAGAGACAGTAACTAAGCCAGGTGATTGCAG TGTGAGAGACCAGG

AATTGTTACAGACCGCCCCTCAAGAAGCTGGAGATGAAGGCAAGCTGCACTCTGCAGAAGAGG CTGCTTGTGAGTTTTCTGAGGGCATAAGAAACATTG

AACATCATCAATGCAGTGATGATTTAAACCCTACTGAGAATCATGCAACTGAAAGGCATCCAGAAAAATGTCAGAGTATTTCTATTTCAAATGTGTGTGT

GGAGCCATGTGGCACAGATGCTCATGCCAGCTCATTACAGCCTGAGACCAGCAGTTTATTGCTCATTGAAGACAGAATGAATGCAGAAAAGGCTGAATTC

TGTAATAAAAGCAAACAGCCTGGCATAGCAGTGAGCCAGCAGAGCAGATGGGCTGCAAGTAAAGGAACATGTAACGACAGGCAGGTTCCCAGCACTGGGG

AAAAGGTAGGTCCAAACGCTGACTCCCTTAGTGATAGAGAGAAGTGGACTCACCCGCAAAGTCTGTGCCCTGAGAATTCTGGAGCTACCACCGATGTTCC

TTGGATAACACTAAATAGCAGCGTTCAGAAAGTTAATGAGTGGTTTTCCAGAACTGGTGAAATGTTAACTTCTGACAGCGCATCTGCCAGGAGGCACGAG

TCAAATGCTGAAGCAGCTGTTGTGTTGGAAGTTTCAAACGAAGTGGATGGGGGTTTTAGTTCTTCAAGGAAAACAGACTTAGTAACCCCCGACCCCCATC

ATACTTTAATGTGTAAAAGTGGAAGAGACTTCTCCAAACCAGTAGAGGATAATATCAGTGATAAAATATTTGGGAAATCCTATCAGAGAAAGGGAAGCCG

CCCTCACCTGAACCATGTGACTGAAATTATAGGCACATTTATTACAGAACCACAGATAACACAAGAGCAGCCCTTCACAAATAAATTAAAACGTAAGAGA

AGTACATCCCTTCAACCTGAGGACTTCATCAAGAAAGCAGATTCAGCAGGTGTTCAAAGGACTCCTGACAACATAAATCAGGGAACTGACCTAATGGAGC

CAAATGAGCAAGCAGTGAGTACTACCAGTAACTGTCAGGAGAACAAAATAGCAGGTAGTAATCTCCAGAAAGAGAAAAGCGCTCATCCAACTGAATCATT

GAGAAAGGAACCTGCTTCCACAGCAGGAGCCAAATCTATAAGCAACAGTGTAAGTGATTTGGAGGTAGAATTAAACGTCCACAGTTCAAAAGCACCTAAG

AAAAATAGGCTGAGGAGGAAGTCTTCTATCAGGTGTGCTCTTCCACTTGAACCAATCAGTAGAAATCCAAGCCCACCTACTTGTGCTGAGCTTCAAATCG

ATAGTTGTGGTAGCAGTGAAGAAACAAAGAAAAACCATTCCAACCAACAGCCAGCCGGGCACCTTAGAGAGCCTCAACTCATCGAAGACACTGAACCTGC

AGCGGATGCCAAGAAGAACGAGCCAAATGAACACATAAGGAAGAGACGTGCCAGCGATGCTTTCCCAGAAGAGAAATTAATGAACAAAGCTGGTTTATTA

ACTAGCTGTTCAAGTCCTAGAAAATCTCAAGGGCCTGTCAATCCCAGCCCTCAGAGAACAGGAACAGAGCAACTTGAAACACGCCAAATGTCTGACAGTG

CCAAAGAACTCGGGGATCGGGTCCTAGGAGGAGAGCCCAGTGGCAAAACCACTGACCGATCTGAGGAGAGCACCAGCGTATCCTTGGTATCTGACACTGA

CTACGACACTCAGAACAGTGTCTCAGTCCTGGACGCTCACACTGTCAGATATGCAAGAACAGGATCCGCTCAGTGTATGACTCAGTTTGTAGCAAGCGAA

AACCCCAAGGAACTCGTCCATGGCTCTAACAATGCTGGGAGTGGCACAGAGGGTCTCAAGCCCCCCTTGAGACACGCGCTTAACCTCAGTCAGGAGAAAG

TAGAAATGGAAGACAGTGAACTTGATACTCAGTATTTGCAGAATACATTTCAAGTTTCAAAGCGTCAGTCATTTGCTTTATTTTCAAAACCTAGAAGTCC

CCAAAAGGACTGTGCTCACTCTGTGCCCTCAAAGGAACTGAGTCCAAAGGTGACAGCTAAAGGTAAACAAAAAGAACGTCAGGGACAGGAAGAATTTGAA

ATCAGTCACGTACAAGCAGTTGCGGCCACAGTGGGCTTACCTGTGCCCTGTCAAGAAGGTAAGCTAGCTGCTGATACAATGTGTGATAGAGGTTGTAGGC

TTTGTCCATCATCTCATTACAGAAGCGGGGAGAATGGACTCAGCGCCACAGGTAAATCAGGAATTTCACAAAACTCACATTTTAAACAATCAGTTTCTCC

CATCAGGTCATCTATAAAAACTGACAATAGGAAACCTCTGACAGAGGGACGATTTGAGAGACATACATCATCAACTGAGATGGCGGTGGGAAATGAGAAC

ATTCTTCAGAGTACAGTGCACACAGTTAGCCTGAATAACAGAGGAAATGCTTGTCAAGAAGCCGGCTCGGGCAGTATTCATGAAGTATGTTCCACTGGTG

ACTCCTTCCCAGGACAACTAGGTAGAAACAGAGGGCCTAAGGTGAACACTGTGCCTCCATTAGATAGTATGCAGCCTGGTGTCTGTCAGCAAAGTGTTCC

TGTAAGTGATAAGTATCTTGAAATAAAAAAGCAGGAGGGTGAGGCTGTCTGTGCAGACTTCTCTCCATGTCTATTCTCAGACCATCTTGAGCAATCTATG

AGTGGTAAGGTTTTTCAGGTTTGCTCTGAGACACCTGATGACCTGCTGGATGATGTTGAAATACAGGGACATACTAGCTTTGGTGAAGGTGACATAATGG

AGAGATCTGCTGTCTTTAACGGAAGCATCCTGAGAAGGGAGTCCAGTAGGAGCCCTAGTCCTGTAACCCATGCATCGAAGTCTCAGAGTCTCCACAGAGC

GTCTAGGAAATTAGAATCGTCAGAAGAGAGCGACTCCACTGAGGATGAAGATCTTCCCTGCTTCCAACACTTACTGAGCAGAATAAGCAACACACCTGAG

CTTACCAGATGCAGCAGTGCTGTGACACAGCGTATGCCAGAGAAAGCGGAGGGGACCCAAGCACCATGGAAGGGTAGCAGCAGTGACTGCAATAATGAGG

TGATCATGATAGAGGCATCTCAGGAGCATCAGTTTAGTGAGGATCCAAGATGCTCTGGCAGCATGTTCTCTTCACAGCACAGTGCTGCCCAAGGGTCAAC

TGCAAATGCAAACTCCCAGGATTCCAATTTTATTCCACCTTCCAAACAGAGGAGTCACCAGTGTGGGAATGAGGAAGCTTTCCTAAGTGACAAGGAATTG

ATTTCAGATAACGAGGAAATGGCAACTTGCCTAGAAGAGGATAATGACCAAGAAGAGGATAGTATAATCCCAGATTCAG - UNI6104 - AGGCATCC

GGATACGAGAGTGAAACAAACCTTTCTGAAGACTGCTCGCAGAGTGATATTTTAACCACTCAG CAGCGGGCGACCATGAAGTATAACCTGATAAAGCTG

CAGCAGGAAATGGCTCACCTGGAAGCTGTGCTGGAGCAGCGTGGGAACCAGCCTTCTGGCCACTCCCCTTCCCTCCTAGCGGACCCTTGTGCCCTGGAAG

ACCTGCCAGATCTGGAACCAAACATGTCAGGAGCAG CAATTTTAACTTCAAAGAACATTAATGAGAATCCTGTAAGCCAAAATTTGAAGAGCGCTTGTG

ATGACAAATTCCAACTACAACATCTGGAGGGTCCCACCAGTGGAGATGACGAGTCAGGGATGGGAAG - UNI7042 - GCCTTCCCCTTTTAAATCTC

CGTTGGCAGGCAGTAGGGGCTCTGCACATGGCTGCTCTAGGCATCTTCAAAAGAGAAACTCCCCCTCTCAGGAGGAGCTCCTCCAGCCTGCTGGATCAGA

GGCGTCATCTGAGCCACACAATTCAACAGGGCAGTCTTGCCTGCCAAGGCGAGAGCTAG AAGGAACCCCATACCTGGGATCTGGAATCAGCCTTTTCTC

TAGTAGAGACCCCGAATCTGAGTCCCCTAAAGAGCCAGCCCACATTGGCACCACACCAGCTTCAACCTCTGCACTGAAAATACCCCAAGGTCAAGTTGCT

TTCCGGAGTGCAGCTGCTGCTGGTGCTGATAAAGCAGTGGTAGGAATTGTGAGCAAGATAAAGCCGGAATTGACATCTTCAGAAGAAAGAGCGGATAGAG

ACATATCCATGGTGGTGTCAGGCTTGACCCCCAAAGAAGTA - UNI3247 - ATGACCGTGCAAAAGTTTGCTGAAAAATACCGCCTCACTTTAACTG

ACGCAATTACTGAGGAGACTACACATGTAATTATAAAAACAG - UNI12098 - ATGCGGAGTTTGTGTGTGAGCGGACACTGAAATATTTTCTGGGC

ATTGCAGGAGGAAAGTGGATAGTTAGCTATTCAT - UNI5315 - GGGTGGTCCGGTCTATCCAAGAAAGAAGACTTCTGAATGTG CATGAATTTGA

AGTCAAAGGAGATGTTGTGACTGGAAGAAATCACCAAGGTCCAAGGCGATCCAGAGAATCCCGGGAAAAG CTCTTCAAGGGCCTACAGGTCTATTGTTG

TGAGCCCTTCACCAACATGCCCAAAG - UNI18492 - ATGAGCTGGAGAGGATGCTGCAGCTGTGTGGGGCTTCCGTGGTGAAGGAGCTTCCATCGC

TCACCCATGACACA GGTGCTCATCTAGTTGTGATCGTGCAGCCAAGCGCCTGGACAGAAGACAGCAACTGCCCAG ATATTGGGCAGCTGTGCAAGGCA

CGTCTTGTGATGTGGGACTGGGTGTTGGACAGTCTATCCAGCTACCGGTGTCGGGATCTGGATGCCTACCTGGTACAGAATATCACCTGTGACAGTAGTG

AGCCACAAGACTCCAATGATTAATTTAAGAAATGGTCTTCCATGCCCGGGGAGCACCTCTCAGTCTTTGGTGCTTCCACACCCTACTTACTAAGTATTTT

TCATGCATCCGCCTGGAAAAACCAGCTTCTACCTATGTGAGGGTGGGTGCCTTAAAGGTTTTCTAACCAAGTCCCCCTTTGAAGTCTGTCTTGAACACAA

AAAGTTTTCACCTGAGAAAGCTTTATCCCACCAATTGAGCAAGATGCTAATCTGTTGCATATCGTTCTTGGAGAGACAGTAGAGTGGCTTGGCTGATCTG

AGCTGGGCATGGTGGTACTTGCCTATAATCACAGCATTTGGTGGAAAGAGATGGGCATGTCGTGAGTTGTATATGACTGAAGAACAAATAGCTAGTGGTC

CTGATTTGTTCCTTATAAAATTGCATGTTCATAAAGGCCAAGAGTCAAGTCCTTCAAGGAGATGGCTTGAGATCTGTGGTTTGACTTAAAATCAGTGCTC

CTCAAGGCTCCAGGTTTAGTAGCCAGCACCAAACAACACCCAGAATAGGGTTTGTGCAGGACACTGAGGAAATTCAGAGCCAGATTATGTATTTGATGTG

AATGTGAGGTTTTTCAAGTGCCAGTGTCAAGGAGAGCCTTCTAATTCCCCATAGCTTATGAGCAGTGTATCTGTTGTAGCAGCTCTAAGTAACCCATTCT

TCTTTAAATACACGGACTCTGATATGAATATTTCATGTCTGTACAATGATGGATTCCACCAGGAAAGGAGTTGTTGCTTTCTTTGAAGTAATTTCTTCCC

TTTTGCTCCCTGTTGCTGAGGCATACTACTTCATAAATAATTTTGCTTGCTGAAGGAAGAGAACATATTTTTCATGAACTCATAATCTTGGACTGTTTAT

AGATATTGGGGGGAGTAGGTCTTCTCTGGCCCCCCCCAGTATGCAAGGGCAATGGAGACCTGATTATATAAAGTATGTTTATAAATGCTGTGCTGTTAAT

ACTGCAAATAAACTAAATAGCAAACA
Translation
MDLSAVQIQEVQNVLHAMQKILECPIC - UNI10449 - - UNI18590 - CLELIKEPVSTKCDHIFCK KFCMLKLLNQKKGPSQCPLCKNEITK

R - UNI22607 - RSLQGSTRFSQLAEELLRIMAAFELDTGMQL - UNI5548 - LTNGFSFSKKRNNSCERLNEEASIIQSVGYRNRVRRLPQVE

PGNATL - UNI2041 - KDSLGVQLSNLGIVRSVKKNRQTQPRKKSVYIELD DSDSSEETVTKPGDCS SVRDQELLQTAPQEAGDEGKLHSAEEA 

AACEFSEGIRNIEHHQCSDDLNPTENHATERHPEKCQSISISNVCVEPCGTDAHASSLQPETSSLLLIEDRMNAEKAEFCNKSKQPGIAVSQQSRWAASK

GTCNDRQVPSTGEKVGPNADSLSDREKWTHPQSLCPENSGATTDVPWITLNSSVQKVNEWFSRTGEMLTSDSASARRHESNAEAAVVLEVSNEVDGGFSS

SRKTDLVTPDPHHTLMCKSGRDFSKPVEDNISDKIFGKSYQRKGSRPHLNHVTEIIGTFITEPQITQEQPFTNKLKRKRSTSLQPEDFIKKADSAGVQRT

PDNINQGTDLMEPNEQAVSTTSNCQENKIAGSNLQKEKSAHPTESLRKEPASTAGAKSISNSVSDLEVELNVHSSKAPKKNRLRRKSSIRCALPLEPISR

NPSPPTCAELQIDSCGSSEETKKNHSNQQPAGHLREPQLIEDTEPAADAKKNEPNEHIRKRRASDAFPEEKLMNKAGLLTSCSSPRKSQGPVNPSPQRTG

TEQLETRQMSDSAKELGDRVLGGEPSGKTTDRSEESTSVSLVSDTDYDTQNSVSVLDAHTVRYARTGSAQCMTQFVASENPKELVHGSNNAGSGTEGLKP

PLRHALNLSQEKVEMEDSELDTQYLQNTFQVSKRQSFALFSKPRSPQKDCAHSVPSKELSPKVTAKGKQKERQGQEEFEISHVQAVAATVGLPVPCQEGK

LAADTMCDRGCRLCPSSHYRSGENGLSATGKSGISQNSHFKQSVSPIRSSIKTDNRKPLTEGRFERHTSSTEMAVGNENILQSTVHTVSLNNRGNACQEA

GSGSIHEVCSTGDSFPGQLGRNRGPKVNTVPPLDSMQPGVCQQSVPVSDKYLEIKKQEGEAVCADFSPCLFSDHLEQSMSGKVFQVCSETPDDLLDDVEI

QGHTSFGEGDIMERSAVFNGSILRRESSRSPSPVTHASKSQSLHRASRKLESSEESDSTEDEDLPCFQHLLSRISNTPELTRCSSAVTQRMPEKAEGTQA

PWKGSSSDCNNEVIMIEASQEHQFSEDPRCSGSMFSSQHSAAQGSTANANSQDSNFIPPSKQRSHQCGNEEAFLSDKELISDNEEMATCLEEDNDQEEDS

IIPDSE - UNI6104 - EASGYESETNLSEDCSQSDILTTQ QRATMKYNLIKLQQEMAHLEAVLEQRGNQPSGHSPSLLADPCALEDLPDLEPNMSG

AA AILTSKNINENPVSQNLKSACDDKFQLQHLEGPTSGDDESGMGR - UNI7042 - RPSPFKSPLAGSRGSAHGCSRHLQKRNSPSQEELLQPAGS

EASSEPHNSTGQSCLPRRELE EGTPYLGSGISLFSSRDPESESPKEPAHIGTTPASTSALKIPQGQVAFRSAAAAGADKAVVGIVSKIKPELTSSEERA

DRDISMVVSGLTPKEV - UNI3247 - MTVQKFAEKYRLTLTDAITEETTHVIIKTD - UNI12098 - DAEFVCERTLKYFLGIAGGKWIVSYSW

 - UNI5315 - WVVRSIQERRLLNV HEFEVKGDVVTGRNHQGPRRSRESREK LFKGLQVYCCEPFTNMPKD - UNI18492 - DELERMLQLCG

ASVVKELPSLTHDT GAHLVVIVQPSAWTEDSNCPD DIGQLCKARLVMWDWVLDSLSSYRCRDLDAYLVQNITCDSSEPQDSND
Transcript ENSMUST00000017290
Sequence
GTCCTCGGCGCTTGGAAGTACGGATCTTTTTTCTCGGAGAAAAG - UNI10712 - - UNI18590 - TTCACTGGAACTGGAAGAAATGGATTTAT

CTGCCGTCCAAATTCAAGAAGTACAAAATGTCCTTCATGCTATGCAGAAAATCTTAGAGTGTCCGATCTG - UNI10449 - - UNI18590 - TTT

GGAACTGATCAAAGAACCTGTTTCCACAAAGTGTGACCACATATTTTGCAA ATTTTGTATGCTGAAACTTCTTAACCAGAAGAAAGGGCCTTCACAATG

TCCTTTGTGTAAGAATGAGATAACCAAAAG - UNI22607 - GAGCCTACAGGGAAGCACAAGGTTTAGTCAGCTTGCTGAAGAGCTGCTGAGAATAA

TGGCTGCTTTTGAGCTTGACACGGGAATGCAGC - UNI5548 - TTACAAATGGTTTTAGTTTTTCAAAAAAGAGAAATAATTCTTGTGAGCGTTTGA

ATGAGGAGGCGTCGATCATCCAGAGCGTGGGCTACCGGAACCGTGTCAGAAGGCTTCCCCAGGTCGAACCTGGAAATGCCACCTTG - UNI2041 - A

AGGACAGCCTAGGTGTCCAGCTGTCTAACCTTGGAATCGTGAGATCAGTGAAGAAAAACAGGCAGACCCAACCTCGAAAGAAATCTGTCTACATTGAACT

AG ACTCTGATTCTTCTGAAGAGACAGTAACTAAGCCAGGTGATTGCAG TGTGAGAGACCAGGAATTGTTACAGACCGCCCCTCAAGAAGCTGGAGATG

AAGGCAAGCTGCACTCTGCAGAAGAGG CTGCTTGTGAGTTTTCTGAGGGCATAAGAAACATTGAACATCATCAATGCAGTGATGATTTAAACCCTACTG

AGAATCATGCAACTGAAAGGCATCCAGAAAAATGTCAGAGTATTTCTATTTCAAATGTGTGTGTGGAGCCATGTGGCACAGATGCTCATGCCAGCTCATT

ACAGCCTGAGACCAGCAGTTTATTGCTCATTGAAGACAGAATGAATGCAGAAAAGGCTGAATTCTGTAATAAAAGCAAACAGCCTGGCATAGCAGTGAGC

CAGCAGAGCAGATGGGCTGCAAGTAAAGGAACATGTAACGACAGGCAGGTTCCCAGCACTGGGGAAAAGGTAGGTCCAAACGCTGACTCCCTTAGTGATA

GAGAGAAGTGGACTCACCCGCAAAGTCTGTGCCCTGAGAATTCTGGAGCTACCACCGATGTTCCTTGGATAACACTAAATAGCAGCGTTCAGAAAGTTAA

TGAGTGGTTTTCCAGAACTGGTGAAATGTTAACTTCTGACAGCGCATCTGCCAGGAGGCACGAGTCAAATGCTGAAGCAGCTGTTGTGTTGGAAGTTTCA

AACGAAGTGGATGGGGGTTTTAGTTCTTCAAGGAAAACAGACTTAGTAACCCCCGACCCCCATCATACTTTAATGTGTAAAAGTGGAAGAGACTTCTCCA

AACCAGTAGAGGATAATATCAGTGATAAAATATTTGGGAAATCCTATCAGAGAAAGGGAAGCCGCCCTCACCTGAACCATGTGACTGAAATTATAGGCAC

ATTTATTACAGAACCACAGATAACACAAGAGCAGCCCTTCACAAATAAATTAAAACGTAAGAGAAGTACATCCCTTCAACCTGAGGACTTCATCAAGAAA

GCAGATTCAGCAGGTGTTCAAAGGACTCCTGACAACATAAATCAGGGAACTGACCTAATGGAGCCAAATGAGCAAGCAGTGAGTACTACCAGTAACTGTC

AGGAGAACAAAATAGCAGGTAGTAATCTCCAGAAAGAGAAAAGCGCTCATCCAACTGAATCATTGAGAAAGGAACCTGCTTCCACAGCAGGAGCCAAATC

TATAAGCAACAGTGTAAGTGATTTGGAGGTAGAATTAAACGTCCACAGTTCAAAAGCACCTAAGAAAAATAGGCTGAGGAGGAAGTCTTCTATCAGGTGT

GCTCTTCCACTTGAACCAATCAGTAGAAATCCAAGCCCACCTACTTGTGCTGAGCTTCAAATCGATAGTTGTGGTAGCAGTGAAGAAACAAAGAAAAACC

ATTCCAACCAACAGCCAGCCGGGCACCTTAGAGAGCCTCAACTCATCGAAGACACTGAACCTGCAGCGGATGCCAAGAAGAACGAGCCAAATGAACACAT

AAGGAAGAGACGTGCCAGCGATGCTTTCCCAGAAGAGAAATTAATGAACAAAGCTGGTTTATTAACTAGCTGTTCAAGTCCTAGAAAATCTCAAGGGCCT

GTCAATCCCAGCCCTCAGAGAACAGGAACAGAGCAACTTGAAACACGCCAAATGTCTGACAGTGCCAAAGAACTCGGGGATCGGGTCCTAGGAGGAGAGC

CCAGTGGCAAAACCACTGACCGATCTGAGGAGAGCACCAGCGTATCCTTGGTATCTGACACTGACTACGACACTCAGAACAGTGTCTCAGTCCTGGACGC

TCACACTGTCAGATATGCAAGAACAGGATCCGCTCAGTGTATGACTCAGTTTGTAGCAAGCGAAAACCCCAAGGAACTCGTCCATGGCTCTAACAATGCT

GGGAGTGGCACAGAGGGTCTCAAGCCCCCCTTGAGACACGCGCTTAACCTCAGTCAGGAGAAAGTAGAAATGGAAGACAGTGAACTTGATACTCAGTATT

TGCAGAATACATTTCAAGTTTCAAAGCGTCAGTCATTTGCTTTATTTTCAAAACCTAGAAGTCCCCAAAAGGACTGTGCTCACTCTGTGCCCTCAAAGGA

ACTGAGTCCAAAGGTGACAGCTAAAGGTAAACAAAAAGAACGTCAGGGACAGGAAGAATTTGAAATCAGTCACGTACAAGCAGTTGCGGCCACAGTGGGC

TTACCTGTGCCCTGTCAAGAAGGTAAGCTAGCTGCTGATACAATGTGTGATAGAGGTTGTAGGCTTTGTCCATCATCTCATTACAGAAGCGGGGAGAATG

GACTCAGCGCCACAGGTAAATCAGGAATTTCACAAAACTCACATTTTAAACAATCAGTTTCTCCCATCAGGTCATCTATAAAAACTGACAATAGGAAACC

TCTGACAGAGGGACGATTTGAGAGACATACATCATCAACTGAGATGGCGGTGGGAAATGAGAACATTCTTCAGAGTACAGTGCACACAGTTAGCCTGAAT

AACAGAGGAAATGCTTGTCAAGAAGCCGGCTCGGGCAGTATTCATGAAGTATGTTCCACTGGTGACTCCTTCCCAGGACAACTAGGTAGAAACAGAGGGC

CTAAGGTGAACACTGTGCCTCCATTAGATAGTATGCAGCCTGGTGTCTGTCAGCAAAGTGTTCCTGTAAGTGATAAGTATCTTGAAATAAAAAAGCAGGA

GGGTGAGGCTGTCTGTGCAGACTTCTCTCCATGTCTATTCTCAGACCATCTTGAGCAATCTATGAGTGGTAAGGTTTTTCAGGTTTGCTCTGAGACACCT

GATGACCTGCTGGATGATGTTGAAATACAGGGACATACTAGCTTTGGTGAAGGTGACATAATGGAGAGATCTGCTGTCTTTAACGGAAGCATCCTGAGAA

GGGAGTCCAGTAGGAGCCCTAGTCCTGTAACCCATGCATCGAAGTCTCAGAGTCTCCACAGAGCGTCTAGGAAATTAGAATCGTCAGAAGAGAGCGACTC

CACTGAGGATGAAGATCTTCCCTGCTTCCAACACTTACTGAGCAGAATAAGCAACACACCTGAGCTTACCAGATGCAGCAGTGCTGTGACACAGCGTATG

CCAGAGAAAGCGGAGGGGACCCAAGCACCATGGAAGGGTAGCAGCAGTGACTGCAATAATGAGGTGATCATGATAGAGGCATCTCAGGAGCATCAGTTTA

GTGAGGATCCAAGATGCTCTGGCAGCATGTTCTCTTCACAGCACAGTGCTGCCCAAGGGTCAACTGCAAATGCAAACTCCCAGGATTCCAATTTTATTCC

ACCTTCCAAACAGAGGAGTCACCAGTGTGGGAATGAGGAAGCTTTCCTAAGTGACAAGGAATTGATTTCAGATAACGAGGAAATGGCAACTTGCCTAGAA

GAGGATAATGACCAAGAAGAGGATAGTATAATCCCAGATTCAG - UNI6104 - AGGCATCCGGATACGAGAGTGAAACAAACCTTTCTGAAGACTGC

TCGCAGAGTGATATTTTAACCACTCAG CAGCGGGCGACCATGAAGTATAACCTGATAAAGCTGCAGCAGGAAATGGCTCACCTGGAAGCTGTGCTGGAG

CAGCGTGGGAACCAGCCTTCTGGCCACTCCCCTTCCCTCCTAGCGGACCCTTGTGCCCTGGAAGACCTGCCAGATCTGGAACCAAACATGTCAGGAGCAG

 CAATTTTAACTTCAAAGAACATTAATGAGAATCCTGTAAGCCAAAATTTGAAGAGCGCTTGTGATGACAAATTCCAACTACAACATCTGGAGGGTCCCA

CCAGTGGAGATGACGAGTCAGGGATGGGAAG - UNI7042 - GCCTTCCCCTTTTAAATCTCCGTTGGCAGGCAGTAGGGGCTCTGCACATGGCTGCT

CTAGGCATCTTCAAAAGAGAAACTCCCCCTCTCAGGAGGAGCTCCTCCAGCCTGCTGGATCAGAGGCGTCATCTGAGCCACACAATTCAACAGGGCAGTC

TTGCCTGCCAAGGCGAGAGCTAG AAGGAACCCCATACCTGGGATCTGGAATCAGCCTTTTCTCTAGTAGAGACCCCGAATCTGAGTCCCCTAAAGAGCC

AGCCCACATTGGCACCACACCAGCTTCAACCTCTGCACTGAAAATACCCCAAGGTCAAGTTGCTTTCCGGAGTGCAGCTGCTGCTGGTGCTGATAAAGCA

GTGGTAGGAATTGTGAGCAAGATAAAGCCGGAATTGACATCTTCAGAAGAAAGAGCGGATAGAGACATATCCATGGTGGTGTCAGGCTTGACCCCCAAAG

AAGTA - UNI3247 - ATGACCGTGCAAAAGTTTGCTGAAAAATACCGCCTCACTTTAACTGACGCAATTACTGAGGAGACTACACATGTAATTATAA

AAACAG - UNI12098 - ATGCGGAGTTTGTGTGTGAGCGGACACTGAAATATTTTCTGGGCATTGCAGGAGGAAAGTGGATAGTTAGCTATTCAT -

 UNI5315 - GGGTGGTCCGGTCTATCCAAGAAAGAAGACTTCTGAATGTG CATGAATTTGAAGTCAAAGGAGATGTTGTGACTGGAAGAAATCACCA

AGGTCCAAGGCGATCCAGAGAATCCCGGGAAAAG CTCTTCAAGGGCCTACAGGTCTATTGTTGTGAGCCCTTCACCAACATGCCCAAAG - UNI1849

2 - ATGAGCTGGAGAGGATGCTGCAGCTGTGTGGGGCTTCCGTGGTGAAGGAGCTTCCATCGCTCACCCATGACACA GGTGCTCATCTAGTTGTGATC

GTGCAGCCAAGCGCCTGGACAGAAGACAGCAACTGCCCAG ATATTGGGCAGCTGTGCAAGGCACGTCTTGTGATGTGGGACTGGGTGTTGGACAGTCTA

TCCAGCTACCGGTGTCGGGATCTGGATGCCTACCTGGTACAGAATATCACCTGTGACAGTAGTGAGCCACAAGACTCCAATGATTAATTTAAGAAATGGT

CTTCCATGCCCGGGGAGCACCTCTCAGTCTTTGGTGCTTCCACACCCTACTTACTAAGTATTTTTCATGCATCCGCCTGGAAAAACCAGCTTCTACCTAT

GTGAGGGTGGGTGCCTTAAAGGTTTTCTAACCAAGTCCCCCTTTGAAGTCTGTCTTGAACACAAAAAGTTTTCACCTGAGAAAGCTT
Translation
 - UNI10712 - - UNI18590 - MDLSAVQIQEVQNVLHAMQKILECPIC - UNI10449 - - UNI18590 - CLELIKEPVSTKCDHIFCK

 KFCMLKLLNQKKGPSQCPLCKNEITKR - UNI22607 - RSLQGSTRFSQLAEELLRIMAAFELDTGMQL - UNI5548 - LTNGFSFSKKRNNS

CERLNEEASIIQSVGYRNRVRRLPQVEPGNATL - UNI2041 - KDSLGVQLSNLGIVRSVKKNRQTQPRKKSVYIELD DSDSSEETVTKPGDCS S

VRDQELLQTAPQEAGDEGKLHSAEEA AACEFSEGIRNIEHHQCSDDLNPTENHATERHPEKCQSISISNVCVEPCGTDAHASSLQPETSSLLLIEDRMN

AEKAEFCNKSKQPGIAVSQQSRWAASKGTCNDRQVPSTGEKVGPNADSLSDREKWTHPQSLCPENSGATTDVPWITLNSSVQKVNEWFSRTGEMLTSDSA

SARRHESNAEAAVVLEVSNEVDGGFSSSRKTDLVTPDPHHTLMCKSGRDFSKPVEDNISDKIFGKSYQRKGSRPHLNHVTEIIGTFITEPQITQEQPFTN

KLKRKRSTSLQPEDFIKKADSAGVQRTPDNINQGTDLMEPNEQAVSTTSNCQENKIAGSNLQKEKSAHPTESLRKEPASTAGAKSISNSVSDLEVELNVH

SSKAPKKNRLRRKSSIRCALPLEPISRNPSPPTCAELQIDSCGSSEETKKNHSNQQPAGHLREPQLIEDTEPAADAKKNEPNEHIRKRRASDAFPEEKLM

NKAGLLTSCSSPRKSQGPVNPSPQRTGTEQLETRQMSDSAKELGDRVLGGEPSGKTTDRSEESTSVSLVSDTDYDTQNSVSVLDAHTVRYARTGSAQCMT

QFVASENPKELVHGSNNAGSGTEGLKPPLRHALNLSQEKVEMEDSELDTQYLQNTFQVSKRQSFALFSKPRSPQKDCAHSVPSKELSPKVTAKGKQKERQ

GQEEFEISHVQAVAATVGLPVPCQEGKLAADTMCDRGCRLCPSSHYRSGENGLSATGKSGISQNSHFKQSVSPIRSSIKTDNRKPLTEGRFERHTSSTEM

AVGNENILQSTVHTVSLNNRGNACQEAGSGSIHEVCSTGDSFPGQLGRNRGPKVNTVPPLDSMQPGVCQQSVPVSDKYLEIKKQEGEAVCADFSPCLFSD

HLEQSMSGKVFQVCSETPDDLLDDVEIQGHTSFGEGDIMERSAVFNGSILRRESSRSPSPVTHASKSQSLHRASRKLESSEESDSTEDEDLPCFQHLLSR

ISNTPELTRCSSAVTQRMPEKAEGTQAPWKGSSSDCNNEVIMIEASQEHQFSEDPRCSGSMFSSQHSAAQGSTANANSQDSNFIPPSKQRSHQCGNEEAF

LSDKELISDNEEMATCLEEDNDQEEDSIIPDSE - UNI6104 - EASGYESETNLSEDCSQSDILTTQ QRATMKYNLIKLQQEMAHLEAVLEQRGNQ

PSGHSPSLLADPCALEDLPDLEPNMSGAA AILTSKNINENPVSQNLKSACDDKFQLQHLEGPTSGDDESGMGR - UNI7042 - RPSPFKSPLAGSR

GSAHGCSRHLQKRNSPSQEELLQPAGSEASSEPHNSTGQSCLPRRELE EGTPYLGSGISLFSSRDPESESPKEPAHIGTTPASTSALKIPQGQVAFRSA

AAAGADKAVVGIVSKIKPELTSSEERADRDISMVVSGLTPKEV - UNI3247 - MTVQKFAEKYRLTLTDAITEETTHVIIKTD - UNI12098 - 

DAEFVCERTLKYFLGIAGGKWIVSYSW - UNI5315 - WVVRSIQERRLLNV HEFEVKGDVVTGRNHQGPRRSRESREK LFKGLQVYCCEPFTNMP

KD - UNI18492 - DELERMLQLCGASVVKELPSLTHDT GAHLVVIVQPSAWTEDSNCPD DIGQLCKARLVMWDWVLDSLSSYRCRDLDAYLVQNI

TCDSSEPQDSND

For any suggestions or comments, please send an email to unitrap@crg.es