Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000017211 (Gsdma2)
Chromosomal location
Chr 11: 98508077 - 98519278 (+)
Description
gasdermin A2 Gene [Source:MGI (curated);Acc:Gsdma2-002]
RefSeq_dna
NM_029727 
RefSeq_peptide
NP_084003.2 
UniGene
Mm.159149 Mm.399354 
MGI
MGI:1921490 
Uniprot/SWISSPROT
Q32M21 
Human Ortholog
ENSG00000167914 (GSDMA)
Omim not available
UniTrap UNI31247
Vector Insertion
Chr 11: 98513945 - 98516182
Public Clones IST12917A3 (tigm) IST14313A11 (tigm) IST11905F10 (tigm) IST13740E12 (tigm)
IST13199B6 (tigm) IST12981D7 (tigm) IST14579B9 (tigm) IST11524E2 (tigm)
IST12566A7 (tigm) IST10621A8 (tigm) IST12177A12 (tigm) IST12628G11 (tigm)
IST10584C6 (tigm) IST10235E3 (tigm) IST11572E3 (tigm) IST11959A11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093938
Sequence
AGTCAGTCATTCTCTCACCCTATAGACAGAACGAGCTCTGGTTCCTTACCACACATCTGCTGCCAGACAGGACCCAGCATCACCCTTCCCTG GAAAATC

TGGATGTGTCTCCTGGATGCTCAG AGACAATGTCTATGTTTGAGGATGTCACCCGGGCCCTGGCTAGACAGCTGAACCCTCGAGGGGATCTGACACCCC

TAGACAGCCTCATCGACTTCAAACGCTTCCATCCCTTCTGCCTGGTGCTGAGGAAGAGGAAGAGCACACTGTTCTGGGGAGCCCGCTATGTGCGCACCGA

CTACACTCTCCTGGATGTGCTGGAGCCGGGCAGCTCCCCCTCAG ATCCAACACTCCTTGGCAATTTTAGCTTTAAGAATATGCTGGATGTCAGAGTAGA

GGGAGATGTGGAGGTGCCAACAATGATGAAGGTAAAGGGGACTGTGGGCCTGTCACAAAGCAGCACGCTGGAGGTACAGATGCTCAGTGTGGCTCCCACG

GCTCTGGAGAACTTGCACATGGAGAG GAAACTGTCAGCAGACCACCCGTTCCTGAAGGAGATGCGGGAATACAAGCAAAACCTGTATGTGGTGATGGAG

GTGGTGAAAGCCAAGCAGGAAGTCACTCTGAAGCGAGCTAGCAACGCAATTTCCAAATTCTCTCTCAACCTTCCCTCACTGGGACTACAG GGATCCGTG

AACCACAAGGAGGCTGTAACCATCCCCAAGGGCTGTGTTCTGGCCTATCGAGTGAGACAACTGATCATCTATGGGAAAGATGAGTGGG GCATTCCATAC

ATTTGTACTGACAACATGCCAACCTTTAACCCCCTGTGTGTGCTTCAGAGACAAGGCAGTACTGTCCAGATGATATCTG - UNI31247 - GGGAGAT

GCACGAAGACTTCAAGACATTAAAGAAAGAGGTTCAGCAAGAGACTCAAGAAGTGGAGAAGTTGAGTCCAGTGGGGCGAAGCTCCCTACTCACTTCCCTC

AGCCATCTCCTAGGAAAGAAGAAAGAGCTCCAGGACCTTGAGCAGATG CTTGAAGGGGCTCTAGACAAGGGACACGAAGTGACCCTTGAAGCACTCCCC

AAAGATGTCCTGCTGTTAAAGGACGCTATGGACGCCATCCTCTACTTCCTCGGGGCTCTGACAG AGCTAAGTGAAGAACAACTGAAGATTCTAGTAAAA

TCCTTGGAGAACAAGGTCCTACCGGTGCAACTGAAGCTG GTTGAGAGCATCTTGGAACAGAACTTCCTGCAAGATAAAGAGGATGTTTTCCCCCTGCGA

CCTGATCTGCTCTCCTCCCTCGGGGAGGAGGACCAGATTCTAACAGAAGCACTGGTGGGACTAAGCGGCCTGGAAGTCCAGAGATCAGGGCCCCAGTACA

CGTGGAATCCAGACACTTGTCACAACCTCTGTGCCCTCTATGCTGGCCTCTCCCTCCTTCACCTGCTAAGCAGGGATTCCTAATGCAACTTCTCTGCCTG

CTGCCCTAAAGCCTTCCCGGCCTTACTGTGCTCTGTCTGAAACACTCCAAGATGGTGGCATTCACCTTTAATCCCAGCAGTCAGGAGGCAGAGGCAGTGA

GTTCAAGACCAGCCTTGTCTACAGGCTGGTTCCAGGATAACAAGGGCTATGTTGTCTCAAAAATAAATAAATAAAAATATCAAATAAATTAG
Translation
  MSMFEDVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSPSD DPTLLGNFSFKNMLDVRVEGDVEVP

TMMKVKGTVGLSQSSTLEVQMLSVAPTALENLHMER RKLSADHPFLKEMREYKQNLYVVMEVVKAKQEVTLKRASNAISKFSLNLPSLGLQ GSVNHKE

AVTIPKGCVLAYRVRQLIIYGKDEWG GIPYICTDNMPTFNPLCVLQRQGSTVQMISG - UNI31247 - GEMHEDFKTLKKEVQQETQEVEKLSPVG

RSSLLTSLSHLLGKKKELQDLEQM LEGALDKGHEVTLEALPKDVLLLKDAMDAILYFLGALTE ELSEEQLKILVKSLENKVLPVQLKL VESILEQNF

LQDKEDVFPLRPDLLSSLGEEDQILTEALVGLSGLEVQRSGPQYTWNPDTCHNLCALYAGLSLLHLLSRDS
Transcript ENSMUST00000017355
Sequence
AGTCAGTCATTCTCTCACCCTATAGACAGAACGAGCTCTGGTTCCTTACCACACATCTGCTGCCAGACAGGACCCAGCATCACCCTTCCCTG GAAAATC

TGGATGTGTCTCCTGGATGCTCAG AGACAATGTCTATGTTTGAGGATGTCACCCGGGCCCTGGCTAGACAGCTGAACCCTCGAGGGGATCTGACACCCC

TAGACAGCCTCATCGACTTCAAACGCTTCCATCCCTTCTGCCTGGTGCTGAGGAAGAGGAAGAGCACACTGTTCTGGGGAGCCCGCTATGTGCGCACCGA

CTACACTCTCCTGGATGTGCTGGAGCCGGGCAGCTCCCCCTCAG GGATCCGTGAACCACAAGGAGGCTGTAACCATCCCCAAGGGCTGTGTTCTGGCCT

ATCGAGTGAGACAACTGATCATCTATGGGAAAGATGAGTGGG GCATTCCATACATTTGTACTGACAACATGCCAACCTTTAACCCCCTGTGTGTGCTTC

AGAGACAAGGCAGTACTGTCCAGATGATATCTG - UNI31247 - GGGAGATGCACGAAGACTTCAAGACATTAAAGAAAGAGGTTCAGCAAGAGACT

CAAGAAGTGGAGAAGTTGAGTCCAGTGGGGCGAAGCTCCCTACTCACTTCCCTCAGCCATCTCCTAGGAAAGAAGAAAGAGCTCCAGGACCTTGAGCAGA

TG CTTGAAGGGGCTCTAGACAAGGGACACGAAGTGACCCTTGAAGCACTCCCCAAAGATGTCCTGCTGTTAAAGGACGCTATGGACGCCATCCTCTACT

TCCTCGGGGCTCTGACAG AGCTAAGTGAAGAACAACTGAAGATTCTAGTAAAATCCTTGGAGAACAAGGTCCTACCGGTGCAACTGAAGCTG GTTGAG

AGCATCTTGGAACAGAACTTCCTGCAAGATAAAGAGGATGTTTTCCCCCTGCGACCTGATCTGCTCTCCTCCCTCGGGGAGGAGGACCAGATTCTAACAG

AAGCACTGGTGGGACTAAGCGGCCTGGAAGTCCAGAGATCAGGGCCCCAGTACACGTGGAATCCAGACACTTGTCACAACCTCTGTGCCCTCTATGCTGG

CCTCTCCCTCCTTCACCTGCTAAGCAGGGATTCCTAATGCAACTTCTCTGCCTGCTGCCCTAAAGCCTTCCCGGCCTTACTGTGCTCTGTCTGAAACACT

CCAAGATGGTGGCATTCACCTTTAATCCCAGCAGTCAGGAGGCAGAGGCAGTGAGTTCAAGACCAGCCTTGTCTACAGGCTGGTTCCAGGATAACAAGGG

CTATGTTGTCTCAAAAATAAATAAATAAAAATATCAAATAAATTAG
Translation
  MCAPTTLSWMCWSRAAPPQ GSVNHKEAVTIPKGCVLAYRVRQLIIYGKDEWG GIPYICTDNMPTFNPLCVLQRQGSTVQMISG - UNI31247 -

 GEMHEDFKTLKKEVQQETQEVEKLSPVGRSSLLTSLSHLLGKKKELQDLEQM LEGALDKGHEVTLEALPKDVLLLKDAMDAILYFLGALTE ELSEEQ

LKILVKSLENKVLPVQLKL VESILEQNFLQDKEDVFPLRPDLLSSLGEEDQILTEALVGLSGLEVQRSGPQYTWNPDTCHNLCALYAGLSLLHLLSRDS


For any suggestions or comments, please send an email to unitrap@crg.es