Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000017264 (Exosc10)
Chromosomal location
Chr 4: 147932553 - 147956502 (+)
Description
exosome component 10 Gene [Source:MGI (curated);Acc:Exosc10-005]
RefSeq_dna
NM_016699 
RefSeq_peptide
NP_057908.1 
MGI
MGI:1355322 
Uniprot/SWISSPROT
P56960 
Uniprot/SPTREMBL
B1ARY9 B2KFQ9 Q3TRD0 Q3UNK6 Q8R2R0 Q99KY7 Q9CVF6 Q9R0B0 B2KFR0 Q8K366 B1AVQ3 B2KG00 Q9CYJ3 
Human Ortholog
ENSG00000171824 (EXOSC10)
Omim not available
UniTrap UNI8892
Vector Insertion
Chr 4: 147932688 - 147933656
Public Clones XL011 (baygenomics) IST14758F8 (tigm) IST14695C11 (tigm)
Private Clones OST56909 (lexicon) OST40377 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7655
Vector Insertion
Chr 4: 147944608 - 147947027
Public Clones RRR770 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15202
Vector Insertion
Chr 4: 147952615 - 147953489
Public Clones PST5857-NL (escells) PST451-1 (escells) PST9932-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8517
Vector Insertion
Chr 4: 147953567 - 147954467
Public Clones RRO051 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000017408
Sequence
GAAGAGCCGCCCTAGGACGGAAAAATGGCGCCTCCCAGTCCCCGGGAGCATCAGTCCGCGCCGGCGACCAGTGCGACCAAGCCTGACGCGGAGATGGTAC

TGCCTGGCTTCCCCGATGCAGACAGCTTCGTAAAG - UNI8892 - TTTGCACTTGGGTCGGTAGTGGCAGTTACCAAGGCATCCGGGGGCCTGCCAC

AGTTCGGTGACGAGTATGATTTTTACAGAAGTTTCCCTGCCTTCCAGGCATTCTGTGAGACACAAGGAGACAGGTTACTGCAGTG CATGAGTCGGGTAA

TGCAGTACCATGGCTGTCGCAGCAACATCAAAGACCGAAGTAAAGTGACTGAATTGGAGGACAAGTTTGATTTATTAGTCGATACCAATGACGTGATATT

GGAGAGAGTG GGCATGTTACTGGATGAAGCCTCCGGTGTGAACAAGCATCAGCAGCCTGTCCTTCCTGCAGGGCTGCAGGTCCCCAAAACAATAGTATC

CAGCTGGAATCGGAAG GCAGGAGAGTATGGCAAAAAGGCAAAATCGGAGACTTTCCGACTGCTGCATGCAAAAAACATCGTGCGACCTCAGCTCAGGTT

TCGAGAGAAGATCGACAATTCTAACACACCATTTCTCCCGAAGATCTTTGTCAAACCCAATGCCCGGAAGCCACTCCCTCTGG CTCTCTCAAAAGAAAG

GCGGGAACGCCCGCAGGACCGTCCGGAGGACCTGGATGTCCCCCCAGCCCTGGCAGATTTCATCCATCAGCAGCGAACCCAGCAGGTGGAGCAGGACAT 

GTTTGCACACCCTTACCAGTATGAACTGGATCACTTTACTCCGCCTCAGTCGGTGCTGCAGAGGCCGAAGCCCCAG TTGTACCGAGCTGTGGGAGAGAC

TCCCTGCCACTTGGTGTCGTCCCTGGATGAGCTGGTGGAGCTCAACGAGAAGCTCCTGGGCTGTCAGGAGTTTGCCGTGGACTTAGAG CATCACTCTTA

CAGAAGCTTCCTAGGACTCACCTGCCTCATGCAGATCTCCACCCGGACAGAAGACTTCATTGTCGACACCCTCGAGCTTCGCAGTGACATGTACATTCTC

AACGAGAGCCTCACGGACCCAGCCATCGTTAAG GTCTTCCATGGTGCCGACTCTGACATTGAGTGGCTGCAGAAAGACTTCGGACTCTATGTGGTGAAC

ATGTTTGACACACACCAGGCAGCACGGCTTCTCAACCTGGCTCGGCACTCACTCGACCATCTGCTGAGACTCTACTGCGGTGTGGAATCAAACAAGCAAT

ATCAGCTGGCAGACTGGAGGATACG TCCTCTGCCAGAGGAAATGCTGAGCTACGCCCGGGATGACACCCATTACCTGCTCTACATCTATGACCGAATGA

GGCTGGAACTGTGGGAAAGAGGCAACCACCAGCCTGTCCAGTTGCAGGTGGTTTGGCAGCGGAGCAGGGACATCTGCCTCAAG AAATTTGTCAAGCCTA

TCTTTACGGACGAGTCCTACCTGGAGCTCTATCGAAAGCAAAAGAAGCACCTGAACTCGCAGCAGCTGACCGCCTTCCAGCTGCTGTTTGCTTGGAGGGA

TAAGACAGCTCGCAGGGAGGATGAGAGCTACGG ATATGTTCTACCAAATCACATGATGCTAAAGATAGCTGAGGAACTGCCTAA GGAGCCTCAAGGCA

TCATAGCTTGCTGTAACCCAGTACCACCTCTTGTCCGGCAGCAGATCAATGAGATGCATCTCCTAATCCAGCAGGCTCGAGAGATGCCCCTGCTCAAG -

 UNI7655 - TCTGAAAATGCAGCTGGAGTGAGGAAGAGCGGACCACTGCCTAGCGCCGAG AGATTGGAGAATGATCTCTTTGGACCCCATGACTGTT

CCCACGCCCCTCCAGATAACTACCAGAACACCTCAACTGATG GGACCCTGCCACTTCAGAAGCAGCCAAGCCTATTCACTGAGGGCAAAGAAGAGACCT

CTGTGGATGCCGGATGCCTCCTTGCCACAGCCGTCATCACTCTGTTCAGT GAACCTAACACTGAGGAAGGTGGAAAGACTCCATTGACGGTGGCCCAGA

AAAAAGCCCAGAACATAATGCAGTCCTTTGAAAACCCATTTCGGATG TTCCTGCCTTCTCTGGAACACAAGGCCCACATCTCTCAAGCAGCAAAGTTTG

ATCCTTCTTCGAAAATCTATGAA ATCAGCAACCGCTGGAAGCTGGCCAGCCAGGTCCAGGTCCAGAAAGAACCTAAAGAAGCAACCAAGAAGAAGGTAG

CTGAGCAAACAG - UNI15202 - CTGCCCGGGAGGAGGCGAAGGAGGAGGCTGCAGCCGGTGTGCTGGAACAGGCTATCCCTGTGCGGCAGCAGGCC

GCG - UNI8517 - CTAGAAAATGCTACTAAGAAGAGAGAACGAGCCACCAGTGACCTGAGGACTATAGAGCAAAAACAGGAGAAGAAACGACTAAAA

AGCTCCAAGAAAGCCAAGGACCCTGATCCCCCAGGGAAAGACTTCAGTCCCTATGACTACAGCCAGTCAGACTTCAGGGCCTTTGCTG GGGACAGTAAA

TCCAAGCCTTCCTCCCAGTTCGACCCCAATAAGCTGGCACCTTCCGGCAAG AAAGGTGTTGGAGCCAAAAAATGTAAACAGTCGGTGGGAAACAAAAGC

ATGTCATTTGCTGTTGGAAAGTCGGACAG AGGCTTCCGCCACAACTGGCCAAAGAGATAGTGCTGGAGGGACTCCTGGGGCTGCCGACAGCGCTGCTTT

GTACACACCCATTTTAAAACCATTAAAATGTATTCCTACC
Translation
MAPPSPREHQSAPATSATKPDAEMVLPGFPDADSFVK - UNI8892 - FALGSVVAVTKASGGLPQFGDEYDFYRSFPAFQAFCETQGDRLLQC CMS

RVMQYHGCRSNIKDRSKVTELEDKFDLLVDTNDVILERV GMLLDEASGVNKHQQPVLPAGLQVPKTIVSSWNRK AGEYGKKAKSETFRLLHAKNIVRP

QLRFREKIDNSNTPFLPKIFVKPNARKPLPLA ALSKERRERPQDRPEDLDVPPALADFIHQQRTQQVEQDM MFAHPYQYELDHFTPPQSVLQRPKPQ 

LYRAVGETPCHLVSSLDELVELNEKLLGCQEFAVDLE HHSYRSFLGLTCLMQISTRTEDFIVDTLELRSDMYILNESLTDPAIVK VFHGADSDIEWLQ

KDFGLYVVNMFDTHQAARLLNLARHSLDHLLRLYCGVESNKQYQLADWRIR RPLPEEMLSYARDDTHYLLYIYDRMRLELWERGNHQPVQLQVVWQRSR

DICLK KFVKPIFTDESYLELYRKQKKHLNSQQLTAFQLLFAWRDKTARREDESYG GYVLPNHMMLKIAEELPK KEPQGIIACCNPVPPLVRQQINEM

HLLIQQAREMPLLK - UNI7655 - SENAAGVRKSGPLPSAE RLENDLFGPHDCSHAPPDNYQNTSTDG GTLPLQKQPSLFTEGKEETSVDAGCLL

ATAVITLFS EPNTEEGGKTPLTVAQKKAQNIMQSFENPFRM FLPSLEHKAHISQAAKFDPSSKIYE ISNRWKLASQVQVQKEPKEATKKKVAEQTA 

- UNI15202 - AAREEAKEEAAAGVLEQAIPVRQQAA - UNI8517 - LENATKKRERATSDLRTIEQKQEKKRLKSSKKAKDPDPPGKDFSPYDY

SQSDFRAFAG GDSKSKPSSQFDPNKLAPSGK KGVGAKKCKQSVGNKSMSFAVGKSDR RGFRHNWPKR
Transcript ENSMUST00000076022
Sequence
GAAGAGCCGCCCTAGGACGGAAAAATGGCGCCTCCCAGTCCCCGGGAGCATCAGTCCGCGCCGGCGACCAGTGCGACCAAGCCTGACGCGGAGATGGTAC

TGCCTGGCTTCCCCGATGCAGACAGCTTCGTAAAG - UNI8892 - TTTGCACTTGGGTCGGTAGTGGCAGTTACCAAGGCATCCGGGGGCCTGCCAC

AGTTCGGTGACGAGTATGATTTTTACAGAAGTTTCCCTGCCTTCCAGGCATTCTGTGAGACACAAGGAGACAGGTTACTGCAGTG CATGAGTCGGGTAA

TGCAGTACCATGGCTGTCGCAGCAACATCAAAGACCGAAGTAAAGTGACTGAATTGGAGGACAAGTTTGATTTATTAGTCGATACCAATGACGTGATATT

GGAGAGAGTG GGCATGTTACTGGATGAAGCCTCCGGTGTGAACAAGCATCAGCAGCCTGTCCTTCCTGCAGGGCTGCAGGTCCCCAAAACAATAGTATC

CAGCTGGAATCGGAAG GCAGGAGAGTATGGCAAAAAGGCAAAATCGGAGACTTTCCGACTGCTGCATGCAAAAAACATCGTGCGACCTCAGCTCAGGTT

TCGAGAGAAGATCGACAATTCTAACACACCATTTCTCCCGAAGATCTTTGTCAAACCCAATGCCCGGAAGCCACTCCCTCTGG CTCTCTCAAAAGAAAG

GCGGGAACGCCCGCAGGACCGTCCGGAGGACCTGGATGTCCCCCCAGCCCTGGCAGATTTCATCCATCAGCAGCGAACCCAGCAGGTGGAGCAGGACAT 

GTTTGCACACCCTTACCAGTATGAACTGGATCACTTTACTCCGCCTCAGTCGGTGCTGCAGAGGCCGAAGCCCCAG TTGTACCGAGCTGTGGGAGAGAC

TCCCTGCCACTTGGTGTCGTCCCTGGATGAGCTGGTGGAGCTCAACGAGAAGCTCCTGGGCTGTCAGGAGTTTGCCGTGGACTTAGAG CATCACTCTTA

CAGAAGCTTCCTAGGACTCACCTGCCTCATGCAGATCTCCACCCGGACAGAAGACTTCATTGTCGACACCCTCGAGCTTCGCAGTGACATGTACATTCTC

AACGAGAGCCTCACGGACCCAGCCATCGTTAAG GTCTTCCATGGTGCCGACTCTGACATTGAGTGGCTGCAGAAAGACTTCGGACTCTATGTGGTGAAC

ATGTTTGACACACACCAGGCAGCACGGCTTCTCAACCTGGCTCGGCACTCACTCGACCATCTGCTGAGACTCTACTGCGGTGTGGAATCAAACAAGCAAT

ATCAGCTGGCAGACTGGAGGATACG TCCTCTGCCAGAGGAAATGCTGAGCTACGCCCGGGATGACACCCATTACCTGCTCTACATCTATGACCGAATGA

GGCTGGAACTGTGGGAAAGAGGCAACCACCAGCCTGTCCAGTTGCAGGTGGTTTGGCAGCGGAGCAGGGACATCTGCCTCAAG AAATTTGTCAAGCCTA

TCTTTACGGACGAGTCCTACCTGGAGCTCTATCGAAAGCAAAAGAAGCACCTGAACTCGCAGCAGCTGACCGCCTTCCAGCTGCTGTTTGCTTGGAGGGA

TAAGACAGCTCGCAGGGAGGATGAGAGCTACGG ATATGTTCTACCAAATCACATGATGCTAAAGATAGCTGAGGAACTGCCTAA GGAGCCTCAAGGCA

TCATAGCTTGCTGTAACCCAGTACCACCTCTTGTCCGGCAGCAGATCAATGAGATGCATCTCCTAATCCAGCAGGCTCGAGAGATGCCCCTGCTCAAG -

 UNI7655 - TCTGAAAATGCAGCTGGAGTGAGGAAGAGCGGACCACTGCCTAGCGCCGAG AGATTGGAGAATGATCTCTTTGGACCCCATGACTGTT

CCCACGCCCCTCCAGATAACTACCAGAACACCTCAACTGATG GGACCCTGCCACTTCAGAAGCAGCCAAGCCTATTCACTGAGGGCAAAGAAGAGACCT

CTGTGGATGCCGGATGCCTCCTTGCCACAGCCGTCATCACTCTGTTCAGT GAACCTAACACTGAGGAAGGTGGAAAGACTCCATTGACGGTGGCCCAGA

AAAAAGCCCAGAACATAATGCAGTCCTTTGAAAACCCATTTCGGATG ATCAGCAACCGCTGGAAGCTGGCCAGCCAGGTCCAGGTCCAGAAAGAACCTA

AAGAAGCAACCAAGAAGAAGGTAGCTGAGCAAACAG - UNI15202 - CTGCCCGGGAGGAGGCGAAGGAGGAGGCTGCAGCCGGTGTGCTGGAACAG

GCTATCCCTGTGCGGCAGCAGGCCGCG - UNI8517 - CTAGAAAATGCTACTAAGAAGAGAGAACGAGCCACCAGTGACCTGAGGACTATAGAGCAA

AAACAGGAGAAGAAACGACTAAAAAGCTCCAAGAAAGCCAAGGACCCTGATCCCCCAGGGAAAGACTTCAGTCCCTATGACTACAGCCAGTCAGACTTCA

GGGCCTTTGCTG GGGACAGTAAATCCAAGCCTTCCTCCCAGTTCGACCCCAATAAGCTGGCACCTTCCGGCAAG AAAGGTGTTGGAGCCAAAAAATGT

AAACAGTCGGTGGGAAACAAAAGCATGTCATTTGCTGTTGGAAAGTCGGACAG AGGCTTCCGCCACAACTGGCCAAAGAGATAGTGCTGGAGGGACTCC

TGGGGCTGCCGACAGCGCTGCTTTGTACACACCCATTTTAAAACCATTAAAATGTATTCCTACC
Translation
MAPPSPREHQSAPATSATKPDAEMVLPGFPDADSFVK - UNI8892 - FALGSVVAVTKASGGLPQFGDEYDFYRSFPAFQAFCETQGDRLLQC CMS

RVMQYHGCRSNIKDRSKVTELEDKFDLLVDTNDVILERV GMLLDEASGVNKHQQPVLPAGLQVPKTIVSSWNRK AGEYGKKAKSETFRLLHAKNIVRP

QLRFREKIDNSNTPFLPKIFVKPNARKPLPLA ALSKERRERPQDRPEDLDVPPALADFIHQQRTQQVEQDM MFAHPYQYELDHFTPPQSVLQRPKPQ 

LYRAVGETPCHLVSSLDELVELNEKLLGCQEFAVDLE HHSYRSFLGLTCLMQISTRTEDFIVDTLELRSDMYILNESLTDPAIVK VFHGADSDIEWLQ

KDFGLYVVNMFDTHQAARLLNLARHSLDHLLRLYCGVESNKQYQLADWRIR RPLPEEMLSYARDDTHYLLYIYDRMRLELWERGNHQPVQLQVVWQRSR

DICLK KFVKPIFTDESYLELYRKQKKHLNSQQLTAFQLLFAWRDKTARREDESYG GYVLPNHMMLKIAEELPK KEPQGIIACCNPVPPLVRQQINEM

HLLIQQAREMPLLK - UNI7655 - SENAAGVRKSGPLPSAE RLENDLFGPHDCSHAPPDNYQNTSTDG GTLPLQKQPSLFTEGKEETSVDAGCLL

ATAVITLFS EPNTEEGGKTPLTVAQKKAQNIMQSFENPFRM ISNRWKLASQVQVQKEPKEATKKKVAEQTA - UNI15202 - AAREEAKEEAAAG

VLEQAIPVRQQAA - UNI8517 - LENATKKRERATSDLRTIEQKQEKKRLKSSKKAKDPDPPGKDFSPYDYSQSDFRAFAG GDSKSKPSSQFDPNK

LAPSGK KGVGAKKCKQSVGNKSMSFAVGKSDR RGFRHNWPKR
Transcript ENSMUST00000097781
Sequence
GAAGAGCCGCCCTAGGACGGAAAAATGGCGCCTCCCAGTCCCCGGGAGCATCAGTCCGCGCCGGCGACCAGTGCGACCAAGCCTGACGCGGAGATGGTAC

TGCCTGGCTTCCCCGATGCAGACAGCTTCGTAAAG - UNI8892 - TTTGCACTTGGGTCGGTAGTGGCAGTTACCAAGGCATCCGGGGGCCTGCCAC

AGTTCGGTGACGAGTATGATTTTTACAGAAGTTTCCCTGCCTTCCAGGCATTCTGTGAGACACAAGGAGACAGGTTACTGCAGTG CATGAGTCGGGTAA

TGCAGTACCATGGCTGTCGCAGCAACATCAAAGACCGAAGTAAAGTGACTGAATTGGAGGACAAGTTTGATTTATTAGTCGATACCAATGACGTGATATT

GGAGAGAGTG GGCATGTTACTGGATGAAGCCTCCGGTGTGAACAAGCATCAGCAGCCTGTCCTTCCTGCAGGGCTGCAGGTCCCCAAAACAATAGTATC

CAGCTGGAATCGGAAG GCAGGAGAGTATGGCAAAAAGGCAAAATCGGAGACTTTCCGACTGCTGCATGCAAAAAACATCGTGCGACCTCAGCTCAGGTT

TCGAGAGAAGATCGACAATTCTAACACACCATTTCTCCCGAAGATCTTTGTCAAACCCAATGCCCGGAAGCCACTCCCTCTGG CTCTCTCAAAAGAAAG

GCGGGAACGCCCGCAGGACCGTCCGGAGGACCTGGATGTCCCCCCAGCCCTGGCAGATTTCATCCATCAGCAGCGAACCCAGCAGGTGGAGCAGGACAT 

GTTTGCACACCCTTACCAGTATGAACTGGATCACTTTACTCCGCCTCAGTCGGTGCTGCAGAGGCCGAAGCCCCAG TTGTACCGAGCTGTGGGAGAGAC

TCCCTGCCACTTGGTGTCGTCCCTGGATGAGCTGGTGGAGCTCAACGAGAAGCTCCTGGGCTGTCAGGAGTTTGCCGTGGACTTAGAG CATCACTCTTA

CAGAAGCTTCCTAGGACTCACCTGCCTCATGCAGATCTCCACCCGGACAGAAGACTTCATTGTCGACACCCTCGAGCTTCGCAGTGACATGTACATTCTC

AACGAGAGCCTCACGGACCCAGCCATCGTTAAG GTCTTCCATGGTGCCGACTCTGACATTGAGTGGCTGCAGAAAGACTTCGGACTCTATGTGGTGAAC

ATGTTTGACACACACCAGGCAGCACGGCTTCTCAACCTGGCTCGGCACTCACTCGACCATCTGCTGAGACTCTACTGCGGTGTGGAATCAAACAAGCAAT

ATCAGCTGGCAGACTGGAGGATACG TCCTCTGCCAGAGGAAATGCTGAGCTACGCCCGGGATGACACCCATTACCTGCTCTACATCTATGACCGAATGA

GGCTGGAACTGTGGGAAAGAGGCAACCACCAGCCTGTCCAGTTGCAGGTGGTTTGGCAGCGGAGCAGGGACATCTGCCTCAAG AAATTTGTCAAGCCTA

TCTTTACGGACGAGTCCTACCTGGAGCTCTATCGAAAGCAAAAGAAGCACCTGAACTCGCAGCAGCTGACCGCCTTCCAGCTGCTGTTTGCTTGGAGGGA

TAAGACAGCTCGCAGGGAGGATGAGAGCTACGG ATATGTTCTACCAAATCACATGATGCTAAAGATAGCTGAGGAACTGCCTAA GGAGCCTCAAGGCA

TCATAGCTTGCTGTAACCCAGTACCACCTCTTGTCCGGCAGCAGATCAATGAGATGCATCTCCTAATCCAGCAGGCTCGAGAGATGCCCCTGCTCAAG -

 UNI7655 - TCTGAAAATGCAGCTGGAGTGAGGAAGAGCGGACCACTGCCTAGCGCCGAG AGATTGGAGAATGATCTCTTTGGACCCCATGACTGTT

CCCACGCCCCTCCAGATAACTACCAGAACACCTCAACTGATG GGACCCTGCCACTTCAGAAGCAGCCAAGCCTATTCACTGAGGGCAAAGAAGAGACCT

CTGTGGATGCCGGATGCCTCCTTGCCACAGCCGTCATCACTCTGTTCAGT GAACCTAACACTGAGGAAGGTGGAAAGACTCCATTGACGGTGGCCCAGA

AAAAAGCCCAGAACATAATGCAGTCCTTTGAAAACCCATTTCGGATG TTCCTGCCTTCTCTGGAACACAAGGCCCACATCTCTCAAGCAGCAAAGTTTG

ATCCTTCTTCGAAAATCTATGAA AGCCCTGGTTTGGTCCCCAGCACAACGTAA
Translation
MAPPSPREHQSAPATSATKPDAEMVLPGFPDADSFVK - UNI8892 - FALGSVVAVTKASGGLPQFGDEYDFYRSFPAFQAFCETQGDRLLQC CMS

RVMQYHGCRSNIKDRSKVTELEDKFDLLVDTNDVILERV GMLLDEASGVNKHQQPVLPAGLQVPKTIVSSWNRK AGEYGKKAKSETFRLLHAKNIVRP

QLRFREKIDNSNTPFLPKIFVKPNARKPLPLA ALSKERRERPQDRPEDLDVPPALADFIHQQRTQQVEQDM MFAHPYQYELDHFTPPQSVLQRPKPQ 

LYRAVGETPCHLVSSLDELVELNEKLLGCQEFAVDLE HHSYRSFLGLTCLMQISTRTEDFIVDTLELRSDMYILNESLTDPAIVK VFHGADSDIEWLQ

KDFGLYVVNMFDTHQAARLLNLARHSLDHLLRLYCGVESNKQYQLADWRIR RPLPEEMLSYARDDTHYLLYIYDRMRLELWERGNHQPVQLQVVWQRSR

DICLK KFVKPIFTDESYLELYRKQKKHLNSQQLTAFQLLFAWRDKTARREDESYG GYVLPNHMMLKIAEELPK KEPQGIIACCNPVPPLVRQQINEM

HLLIQQAREMPLLK - UNI7655 - SENAAGVRKSGPLPSAE RLENDLFGPHDCSHAPPDNYQNTSTDG GTLPLQKQPSLFTEGKEETSVDAGCLL

ATAVITLFS EPNTEEGGKTPLTVAQKKAQNIMQSFENPFRM FLPSLEHKAHISQAAKFDPSSKIYE SPGLVPSTT

For any suggestions or comments, please send an email to unitrap@crg.es