Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000017288 (Vps53)
Chromosomal location
Chr 11: 75859728 - 75993132 (-)
Description
vacuolar protein sorting 53 (yeast) Gene [Source:MGI (curated);Acc:Vps53-001]
RefSeq_dna
NM_026664 
RefSeq_peptide
NP_080940.2 
UniGene
Mm.46397 
MGI
MGI:1915549 
Uniprot/SWISSPROT
Q8CCB4 
Uniprot/SPTREMBL
Q3TJT1 Q3TLZ3 Q3TX19 Q3UDN2 B1AQE9 
Human Ortholog
ENSG00000141252 (VPS53)
Omim not available
UniTrap UNI7458
Vector Insertion
Chr 11: 75988210 - 75992914
Public Clones RRH330 (baygenomics) RRS890 (baygenomics) IST11108D7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3285
Vector Insertion
Chr 11: 75979751 - 75988128
Public Clones AE0831 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2091
Vector Insertion
Chr 11: 75915591 - 75927442
Public Clones XR0372 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4906
Vector Insertion
Chr 11: 75915488 - 75915591
Public Clones AS0733 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18466
Vector Insertion
Chr 11: 75895943 - 75896187
Public Clones not available
Private Clones OST422904 (lexicon)
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28267
Vector Insertion
Chr 11: 75876557 - 75880242
Public Clones not available
Private Clones OST35709 (lexicon)
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8548
Vector Insertion
Chr 11: 75876486 - 75876557
Public Clones RRK433 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000056601
Sequence
GGAAGTGCCAGGCTAGCCGAGTAAGTAGCGGCTCCCTCGAGCCCCGTACCTGGAGGCTTGCTCTTCTGGGGTCCTGGTGACAGACAGGTCGCGAGCAGGA

TTGGAGAGGGCGTCGGGGGCTGAGCGGCGGGATGATGGAGGAGGAGGAACTGGAGTTTGTGGAGGAGCTGGAGGCTGTGCTGCAGCTCACGCCAGAGGTG

CAACTCGCCATCGAGCAG - UNI7458 - GTATTCCCAAGCCAGGATCCTCTTGATCAAGCTGACTTCAATGCCGTTGAGTATATCAATACTCTGTTC

CCAACAGAGCAA - UNI3285 - TCTCTGGCAAACATTGACGATGTTGTGAACAAAATTAGACTGAAAATAAG GAGACTGGATGACAATATCCGGAC

TGTCGTAAGAGGTCAGACAAATGTGGGGCAGGATGGAAGGCAA GCACTTGAAGAGGCCCAGAAAGCCATTCAGCAACTCTTTGGCAAAATCAAGGATAT

CAAAGACAAAGCAGAAAAGTCAGAACAAATG GTGAAAGAGATCACCCGAGATATTAAGCAGTTAGATCACGCCAAGCGCCACCTGACCACCTCAATCAC

GACCCTGAACCACCTGCACATGCTGGCAGGCGGGGTGGACTCCCTGGA AGCCATGACCAGGCGCAGACAGTATGGAGAAGTTGCTAATCTCCTTCAGGG

TGTAATGAATGTTCTGGAGCACTTTCACAAATACATGGGAATCCCACAGATCCGACAGCTTTCTGAAAG GGTGAAGGCTGCACAGACAGAGTTAGGACA

GCAAATCCTGGCTGACTTTGAAGAAGCATTTCCTTCGCAGGGTACCAAG AGGCCGGGAGGACCCAGCAATGTCCTGAGAGATGCGTGCCTGGTGGCTAA

TATTTTGGACCCCAGAATCAAACAAGAAATCATCAAAAAGTTTATTAAACAGCATCTATCAGAGTATCTAGTACTTTTTCAAGAAAACCAAGAT GTCGC

CTGGCTGGACAAAATTGACAGACGTTATGCTTGGGTGAAACGCCAGCTTGTGGACTATGAAGAGAAGTATGGCCGGATGTTTCCTCGGGAGTGGTGCATG

ACGGAGAGGATCTCAGTAGAGTTTTGCCACGTGACGAG GGCAGAACTTTCCAAAATCATGCGTGCCAGAGCTAAGGAAATTGAAGTGAAATTGCTTCTT

TTTGCGATCCAGAGAACAACCAACTTTGAGGGGTTTCTTGCAAAACGCTTCTCCGGTTGCACCCTGACAGATGGAACCCTG - UNI2091 - - UNI4

906 - AAAAAGCTGGAGTCCCCACCACCATCTACCAATCCTTTCCTGGAAGATGAGACAACACCAGAGATGGAGGAGCTGGCTCTGGAGAAAGGAGAGT

TAGAGCAA - UNI4906 - CCGAAGAAGCCCAAGGCCCCGGACAACCCGTTCCACGGCATCGTTTCCAAGTGTTTTGAGCCTCATCTCTACGTGTACA

TTGAGTCCCAGGACAA - UNI18466 - AAACCTCAGCGAGCTGATAGACCGGTTTGTGGCAGATTTCAAAGCCCAGGGCCCACCCAAGCCCAACACT

GACGAAGGGGGTGCTGTGCTCCCCAGCTGCGCTGACCTCTTTGTCTACTACAAGAAGTGCATGGTGCAGTGCTCACAGCTCAGCACAGGCGAGCCCATGA

TCGCCCTGACTACCATCTTCCAGAAGTACCTCCGAGAATACGCCTGGAAAATCCTCTCTGGCAACCTGCCTAA - UNI18466 - AACCAGCAGCAGC

AGTGGGGGGCTGACCATCAGCAGCCTCCTCAAAGAGAAGGAGGGCTCAGAAGTGGCCAGGTTCACTCTGGAGGAGCTGTGTCTCATCTGCAGCATCCTGA

GCACAGCCGAGTATTGTCTGGCTACCACCCAGCAG CTAGAAGAAAAACTCAAAGAAAAAGTTGATGTGAGCCTGACTGAACGAATTAATCTCACAGGAG

AAATGGACACATTCAGCAC TGTCATCTCCAGCAGCATCCAGCTGTTGGTTCAAGATCTGGATGCAGCCTGTGACCCTGCCCTGATTGCCATGAGCAAG 

ATGCCTTGGCAGAACGTGGAGCATGTTGGTGACCAGAGCCCTTATGTCACTTCTGTTATTCTTCACATTAAGCAAAACGTCCCCATCATCCGTGACAACC

TGGCTTCCACACGGAAATACTTCACACAGTTCTGCATTAAATTTGCAAA - UNI8548 - - UNI28267 - TTCGTTCATTCCCAAATTCATCACC

CACCTCTTCAAGTGTAAGCCGATCAGCATGGTGGGAGCAGAGCAG - UNI8548 - CTTCTGCTGGACACCCACTCCCTGAAGATGGTCCTGCTCGAC

CTTCCGTCCATTGGCTCCCAGGTGGTGAGGAAGGCCCCTGCCAGTTACACTAAGATTGTCGTGAAAGGCATGACCCGGGCTGAAATGATCCTTAAG GTG

GTGATGGCCCCTCATGAACCGTTGGTGGTATTTGTTGACAACTACATCAAACTCCTTACGGACTGCAACTCAGAAACCTTCCAGAAAATACTGGATATGA

AG GGGCTGAAGAGGAGTGAGCAGAGCAGCATGCTGGAACTTTTGCGGCAGAGGCTCCCTGCCCCGCCCTCGGGGACAGAAGGTTCCAGCACCCTGTCGC

TGATTGCCCCAACACCGGAGCAGGAGTCATCCCGAATCCGCAAACTGGAGAAACTGATTAAAAAGAGACTGTAAGGAGTGGGAAGGCATGGCCAGAGTCC

TGAACAGCCGACTTCTGCAAACCCTCACACTGAGTCCTGAGTCTTGAAGCCTCTGAGAACATTACGGTTATTAAAGTATCTCTCTCATAACATGTCTTAT

TTTCTATCTCAGTCATGGAAGCTCAGTGAAATCTGTGTTATTAAAAGGCATTTTTAGATT
Translation
MMEEEELEFVEELEAVLQLTPEVQLAIEQ - UNI7458 - VFPSQDPLDQADFNAVEYINTLFPTEQ - UNI3285 - SLANIDDVVNKIRLKIR 

RRLDDNIRTVVRGQTNVGQDGRQ ALEEAQKAIQQLFGKIKDIKDKAEKSEQM VKEITRDIKQLDHAKRHLTTSITTLNHLHMLAGGVDSLE EAMTRR

RQYGEVANLLQGVMNVLEHFHKYMGIPQIRQLSER RVKAAQTELGQQILADFEEAFPSQGTK RPGGPSNVLRDACLVANILDPRIKQEIIKKFIKQHL

SEYLVLFQENQD VAWLDKIDRRYAWVKRQLVDYEEKYGRMFPREWCMTERISVEFCHVTR RAELSKIMRARAKEIEVKLLLFAIQRTTNFEGFLAKRF

SGCTLTDGTL - UNI2091 - - UNI4906 - KKLESPPPSTNPFLEDETTPEMEELALEKGELEQ - UNI4906 - PKKPKAPDNPFHGIVSKC

FEPHLYVYIESQDK - UNI18466 - KNLSELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKKCMVQCSQLSTGEPMIALTTIFQKYLREYA

WKILSGNLPK - UNI18466 - KTSSSSGGLTISSLLKEKEGSEVARFTLEELCLICSILSTAEYCLATTQQ LEEKLKEKVDVSLTERINLTGEMDT

FST TVISSSIQLLVQDLDAACDPALIAMSK MPWQNVEHVGDQSPYVTSVILHIKQNVPIIRDNLASTRKYFTQFCIKFAN - UNI8548 - - UNI

28267 - NSFIPKFITHLFKCKPISMVGAEQ - UNI8548 - LLLDTHSLKMVLLDLPSIGSQVVRKAPASYTKIVVKGMTRAEMILK VVMAPHEP

LVVFVDNYIKLLTDCNSETFQKILDMK GLKRSEQSSMLELLRQRLPAPPSGTEGSSTLSLIAPTPEQESSRIRKLEKLIKKRL
Transcript ENSMUST00000108419
Sequence
GGAAGTGCCAGGCTAGCCGAGTAAGTAGCGGCTCCCTCGAGCCCCGTACCTGGAGGCTTGCTCTTCTGGGGTCCTGGTGACAGACAGGTCGCGAGCAGGA

TTGGAGAGGGCGTCGGGGGCTGAGCGGCGGGATGATGGAGGAGGAGGAACTGGAGTTTGTGGAGGAGCTGGAGGCTGTGCTGCAGCTCACGCCAGAGGTG

CAACTCGCCATCGAGCAG - UNI7458 - GTATTCCCAAGCCAGGATCCTCTTGATCAAGCTGACTTCAATGCCGTTGAGTATATCAATACTCTGTTC

CCAACAGAGCAA - UNI3285 - TCTCTGGCAAACATTGACGATGTTGTGAACAAAATTAGACTGAAAATAAG GAGACTGGATGACAATATCCGGAC

TGTCGTAAGAGGTCAGACAAATGTGGGGCAGGATGGAAGGCAA GCACTTGAAGAGGCCCAGAAAGCCATTCAGCAACTCTTTGGCAAAATCAAGGATAT

CAAAGACAAAGCAGAAAAGTCAGAACAAATG GTGAAAGAGATCACCCGAGATATTAAGCAGTTAGATCACGCCAAGCGCCACCTGACCACCTCAATCAC

GACCCTGAACCACCTGCACATGCTGGCAGGCGGGGTGGACTCCCTGGA AGCCATGACCAGGCGCAGACAGTATGGAGAAGTTGCTAATCTCCTTCAGGG

TGTAATGAATGTTCTGGAGCACTTTCACAAATACATGGGAATCCCACAGATCCGACAGCTTTCTGAAAG GGTGAAGGCTGCACAGACAGAGTTAGGACA

GCAAATCCTGGCTGACTTTGAAGAAGCATTTCCTTCGCAGGGTACCAAG - UNI2091 - - UNI4906 - CCGAAGAAGCCCAAGGCCCCGGACAA

CCCGTTCCACGGCATCGTTTCCAAGTGTTTTGAGCCTCATCTCTACGTGTACATTGAGTCCCAGGACAA - UNI18466 - AAACCTCAGCGAGCTGA

TAGACCGGTTTGTGGCAGATTTCAAAGCCCAGGGCCCACCCAAGCCCAACACTGACGAAGGGGGTGCTGTGCTCCCCAGCTGCGCTGACCTCTTTGTCTA

CTACAAGAAGTGCATGGTGCAGTGCTCACAGCTCAGCACAGGCGAGCCCATGATCGCCCTGACTACCATCTTCCAGAAGTACCTCCGAGAATACGCCTGG

AAAATCCTCTCTGGCAACCTGCCTAA - UNI18466 - AACCAGCAGCAGCAGTGGGGGGCTGACCATCAGCAGCCTCCTCAAAGAGAAGGAGGGCTC

AGAAGTGGCCAGGTTCACTCTGGAGGAGCTGTGTCTCATCTGCAGCATCCTGAGCACAGCCGAGTATTGTCTGGCTACCACCCAGCAG CTAGAAGAAAA

ACTCAAAGAAAAAGTTGATGTGAGCCTGACTGAACGAATTAATCTCACAGGAGAAATGGACACATTCAGCAC TGTCATCTCCAGCAGCATCCAGCTGTT

GGTTCAAGATCTGGATGCAGCCTGTGACCCTGCCCTGATTGCCATGAGCAAG ATGCCTTGGCAGAACGTGGAGCATGTTGGTGACCAGAGCCCTTATGT

CACTTCTGTTATTCTTCACATTAAGCAAAACGTCCCCATCATCCGTGACAACCTGGCTTCCACACGGAAATACTTCACACAGTTCTGCATTAAATTTGCA

AA - UNI8548 - - UNI28267 - TTCGTTCATTCCCAAATTCATCACCCACCTCTTCAAGTGTAAGCCGATCAGCATGGTGGGAGCAGAGCAG -

 UNI8548 - CTTCTGCTGGACACCCACTCCCTGAAGATGGTCCTGCTCGACCTTCCGTCCATTGGCTCCCAGGTGGTGAGGAAGGCCCCTGCCAGTTA

CACTAAGATTGTCGTGAAAGGCATGACCCGGGCTGAAATGATCCTTAAG GTGGTGATGGCCCCTCATGAACCGTTGGTGGTATTTGTTGACAACTACAT

CAAACTCCTTACGGACTGCAACTCAGAAACCTTCCAGAAAATACTGGATATGAAG GGGCTGAAGAGGAGTGAGCAGAGCAGCATGCTGGAACTTTTGCG

GCAGAGGCTCCCTGCCCCGCCCTCGGGGACAGAAGGTTCCAGCACCCTGTCGCTGATTGCCCCAACACCGGAGCAGGAGTCATCCCGAATCCGCAAACTG

GAGAAACTGATTAAAAAGAGACTGTAAGGAGTGGGAAGGCATGGCCAGAGTCCTGAACAGCCGACTTCTGCAAACCCTCACACTGAGTCCTGAGTCTTGA

AGCCTCTGAGAACATTACGGTTATTAAAGTATCTCTCTCATAACATGTCTTATTTTCTATCTCAGTCATGGAAGCTCAGTGAAATCTGTGTTATTAAAAG

GCATTTTTAGATT
Translation
MMEEEELEFVEELEAVLQLTPEVQLAIEQ - UNI7458 - VFPSQDPLDQADFNAVEYINTLFPTEQ - UNI3285 - SLANIDDVVNKIRLKIR 

RRLDDNIRTVVRGQTNVGQDGRQ ALEEAQKAIQQLFGKIKDIKDKAEKSEQM VKEITRDIKQLDHAKRHLTTSITTLNHLHMLAGGVDSLE EAMTRR

RQYGEVANLLQGVMNVLEHFHKYMGIPQIRQLSER RVKAAQTELGQQILADFEEAFPSQGTK - UNI2091 - - UNI4906 - PKKPKAPDNPFH

GIVSKCFEPHLYVYIESQDK - UNI18466 - KNLSELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKKCMVQCSQLSTGEPMIALTTIFQK

YLREYAWKILSGNLPK - UNI18466 - KTSSSSGGLTISSLLKEKEGSEVARFTLEELCLICSILSTAEYCLATTQQ LEEKLKEKVDVSLTERINL

TGEMDTFST TVISSSIQLLVQDLDAACDPALIAMSK MPWQNVEHVGDQSPYVTSVILHIKQNVPIIRDNLASTRKYFTQFCIKFAN - UNI8548 -

 - UNI28267 - NSFIPKFITHLFKCKPISMVGAEQ - UNI8548 - LLLDTHSLKMVLLDLPSIGSQVVRKAPASYTKIVVKGMTRAEMILK VV

MAPHEPLVVFVDNYIKLLTDCNSETFQKILDMK GLKRSEQSSMLELLRQRLPAPPSGTEGSSTLSLIAPTPEQESSRIRKLEKLIKKRL
Transcript ENSMUST00000094015
Sequence
TTCCCTACCCAGGACTTCTTACACCTGGTGCAGAGGCTAAGGGTGGCTTGTCTTTATCTG GCACTTGAAGAGGCCCAGAAAGCCATTCAGCAACTCTTT

GGCAAAATCAAGGATATCAAAGACAAAGCAGAAAAGTCAGAACAAATG GTGAAAGAGATCACCCGAGATATTAAGCAGTTAGATCACGCCAAGCGCCAC

CTGACCACCTCAATCACGACCCTGAACCACCTGCACATGCTGGCAGGCGGGGTGGACTCCCTGGA AGCCATGACCAGGCGCAGACAGTATGGAGAAGTT

GCTAATCTCCTTCAGGGTGTAATGAATGTTCTGGAGCACTTTCACAAATACATGGGAATCCCACAGATCCGACAGCTTTCTGAAAG GGTGAAGGCTGCA

CAGACAGAGTTAGGACAGCAAATCCTGGCTGACTTTGAAGAAGCATTTCCTTCGCAGGGTACCAAG AGGCCGGGAGGACCCAGCAATGTCCTGAGAGAT

GCGTGCCTGGTGGCTAATATTTTGGACCCCAGAATCAAACAAGAAATCATCAAAAAGTTTATTAAACAGCATCTATCAGAGTATCTAGTACTTTTTCAAG

AAAACCAAGAT GTCGCCTGGCTGGACAAAATTGACAGACGTTATGCTTGGGTGAAACGCCAGCTTGTGGACTATGAAGAGAAGTATGGCCGGATGTTTC

CTCGGGAGTGGTGCATGACGGAGAGGATCTCAGTAGAGTTTTGCCACGTGACGAG GGCAGAACTTTCCAAAATCATGCGTGCCAGAGCTAAGGAAATTG

AAGTGAAATTGCTTCTTTTTGCGATCCAGAGAACAACCAACTTTGAGGGGTTTCTTGCAAAACGCTTCTCCGGTTGCACCCTGACAGATGGAACCCTG -

 UNI2091 - - UNI4906 - AAAAAGCTGGAGTCCCCACCACCATCTACCAATCCTTTCCTGGAAGATGAGACAACACCAGAGATGGAGGAGCTGGC

TCTGGAGAAAGGAGAGTTAGAGCAA - UNI4906 - CCGAAGAAGCCCAAGGCCCCGGACAACCCGTTCCACGGCATCGTTTCCAAGTGTTTTGAGCC

TCATCTCTACGTGTACATTGAGTCCCAGGACAA - UNI18466 - AAACCTCAGCGAGCTGATAGACCGGTTTGTGGCAGATTTCAAAGCCCAGGGCC

CACCCAAGCCCAACACTGACGAAGGGGGTGCTGTGCTCCCCAGCTGCGCTGACCTCTTTGTCTACTACAAGAAGTGCATGGTGCAGTGCTCACAGCTCAG

CACAGGCGAGCCCATGATCGCCCTGACTACCATCTTCCAGAAGTACCTCCGAGAATACGCCTGGAAAATCCTCTCTGGCAACCTGCCTAA - UNI1846

6 - AACCAGCAGCAGCAGTGGGGGGCTGACCATCAGCAGCCTCCTCAAAGAGAAGGAGGGCTCAGAAGTGGCCAGGTTCACTCTGGAGGAGCTGTGTCT

CATCTGCAGCATCCTGAGCACAGCCGAGTATTGTCTGGCTACCACCCAGCAG CTAGAAGAAAAACTCAAAGAAAAAGTTGATGTGAGCCTGACTGAACG

AATTAATCTCACAGGAGAAATGGACACATTCAGCAC TGTCATCTCCAGCAGCATCCAGCTGTTGGTTCAAGATCTGGATGCAGCCTGTGACCCTGCCCT

GATTGCCATGAGCAAG ATGCCTTGGCAGAACGTGGAGCATGTTGGTGACCAGAGCCCTTATGTCACTTCTGTTATTCTTCACATTAAGCAAAACGTCCC

CATCATCCGTGACAACCTGGCTTCCACACGGAAATACTTCACACAGTTCTGCATTAAATTTGCAAA - UNI8548 - - UNI28267 - TTCGTTCA

TTCCCAAATTCATCACCCACCTCTTCAAGTGTAAGCCGATCAGCATGGTGGGAGCAGAGCAG - UNI8548 - CTTCTGCTGGACACCCACTCCCTGA

AGATGGTCCTGCTCGACCTTCCGTCCATTGGCTCCCAGGTGGTGAGGAAGGCCCCTGCCAGTTACACTAAGATTGTCGTGAAAGGCATGACCCGGGCTGA

AATGATCCTTAAG GTGGTGATGGCCCCTCATGAACCGTTGGTGGTATTTGTTGACAACTACATCAAACTCCTTACGGACTGCAACTCAGAAACCTTCCA

GAAAATACTGGATATGAAG GGGCTGAAGAGGAGTGAGCAGAGCAGCATGCTGGAACTTTTGCGGCAGAGGCTCCCTGCCCCGCCCTCGGGGACAGAAGG

TTCCAGCACCCTGTCGCTGATTGCCCCAACACCGGAGCAGGAGTCATCCCGAATCCGCAAACTGGAGAAACTGATTAAAAAGAGACTGTAAGGAGTGGGA

AGGCATGGCCAGAGTCCTGAACAGCCGACTTCTGCAAACCCTCACACTGAGTCCTGAGTCTTGAAGCCTCTGAGAACATTACGGTTATTAAAGTATCTCT

CTCATAACATGTCTTATTTTCTATCTCAGTCATGGAAGCTCAGTGAAATCTGTGTTATTAAAAGGCATTTTTAGATT
Translation
FPTQDFLHLVQRLRVACLYL ALEEAQKAIQQLFGKIKDIKDKAEKSEQM VKEITRDIKQLDHAKRHLTTSITTLNHLHMLAGGVDSLE EAMTRRRQY

GEVANLLQGVMNVLEHFHKYMGIP     - UNI2091 - - UNI4906 -  - UNI4906 -  - UNI18466 -  - UNI18466 -     - 

UNI8548 - - UNI28267 -  - UNI8548 -   

For any suggestions or comments, please send an email to unitrap@crg.es