Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000017291 (Taok1)
Chromosomal location
Chr 11: 77342664 - 77421317 (-)
Description
TAO kinase 1 Gene [Source:MGI (curated);Acc:Taok1-001]
RefSeq_dna
NM_144825 
RefSeq_peptide
NP_659074.2 
UniGene
Mm.340436 Mm.433008 Mm.433924 Mm.433927 Mm.474618 
MGI
MGI:1914490 
Uniprot/SWISSPROT
Q5F2E8 
Uniprot/SPTREMBL
B2RX66 Q3UUG1 
Human Ortholog
ENSG00000160551 (TAOK1)
Omim not available
UniTrap UNI19584
Vector Insertion
Chr 11: 77399009 - 77420709
Public Clones 5SE152C02 (ggtc) 5SE129E02 (ggtc) IST14425B7 (tigm) IST14435D1 (tigm)
IST14943D4 (tigm)
Private Clones OST388489 (lexicon) OST330260 (lexicon) OST302067 (lexicon) OST257943 (lexicon)
OST108666 (lexicon) OST99004 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4684
Vector Insertion
Chr 11: 77398774 - 77398997
Public Clones AE0198 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14534
Vector Insertion
Chr 11: 77393275 - 77398997
Public Clones FHCRC-GT-S7-2D1 (fhcrc) IST14539H8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23588
Vector Insertion
Chr 11: 77390871 - 77392227
Public Clones not available
Private Clones OST252387 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27162
Vector Insertion
Chr 11: 77387312 - 77389074
Public Clones not available
Private Clones OST68052 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4162
Vector Insertion
Chr 11: 77373924 - 77377165
Public Clones AM0795 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000058496
Sequence
GGGCTTGGAAGGAGAGAGGGAGGGTGGCGAAGAGAGTGAGCCGGTGCCGCCGCCCGCTTGAGGAGAGAGGAGGGGTCCCACTCGCCTTGCGCCCTTCGCG

GGCTGAGAGCGCGGAGCAGTCGCGAACCTCCCAGGCCTCTCGGCCCCCGGGGACCCCGCCCCGCGGCCCGACGGCCCGCGGCCTCTCTTCTCTTTGTGAG

CGCCCCCTTCCCAGGGGTGGTAGTGGTGGCGGAGGGGTGCGCGTGGGCCCGCCCGCCAAGGGGCCGCGGCGGGGGACCGACAGGGCCTCGGCTGGGAGGA

CCGGAGGCGGCCGAGGCCCCGGTCCGGTTCCCCCGAGGCGGCGGCGGCGGCGACTCCCGGCACTTCCCCCGCGCCATCTTAACTGAGCCGGAGCGTTAAG

GGCGCCTCCTCGACCCCGGTCGTCCCCTCGTCCCCCCCTCCCTCCCCCCGGCCCCTTGTCGTAGAGCCTGGGCTGGGTGGCTGGGGGGGGGGCGGCGGTC

TGTCGCCGGGCCCCCTCCTCCTCACTCCTCGCTCTCCAGCGCTGCGGCCACCGGAGCGCTCCAGGGGTCTGCGCCCGTCTGCTCTGCCCCAGACCTGCCG

GCGAAGGG - UNI4684 - - UNI14534 - - UNI19584 - TTTATGCCAGCGTGGCTTCATTCATACAGATGAACCAAGCATTGGGATAGCAG

TATAAAATTAGAATCAGACAGCTGACTGCTCAGCAGGATGCCATCAACTAACAGAGCAGGCAGTCTAAAGGACCCTGAAATTGCAGAGCTCTTCTTCAAA

GAAGATCCGGAAAAGCTCTTCACAGATCTCAGAGAAATCGGCCATGGGAGCTTTGGAGCAGTATATTTT - UNI4684 - - UNI14534 - GCACG

AGATGTGCGTACTAATGAAGTGGTGGCCATCAAGAAAATGTCTTATAGTGGAAAGCAGTCTACTGAG - UNI14534 - AAATGGCAGGATATTATTA

AGGAAGTCAAGTTTCTACAAAGAATAAAACATCCCAACAGTATAGAATACAAAGGCTGCTATTTACGTGAACACACAGCATGG - UNI23588 - CTT

GTAATGGAATATTGTTTAGGATCTGCTTCAGATTTATTAGAAG TTCATAAAAAGCCATTACAAGAAGTGGAAATAGCAGCAATTACACATGGTGCTCTC

CAGGGACTAGCTTATTTACATTCTCATACCATGATCCATAG - UNI27162 - AGATATCAAAGCAGGAAATATCCTTCTGACAGAACCAGGCCAAGT

GAAACTTGCTGACTTTGGATCTGCTTCCATGGCTTCCCCTGCCAATTCTTTTGTGGGAACACCATATTG GATGGCCCCAGAAGTAATTTTAGCCATGGA

TGAAGGACAGTATGATGGCAAAGTTGATGTATGGTCTCTTGGAATAACGTGTATTGAATTAG CCGAGAGGAAGCCTCCTTTATTTAATATGAATGCAAT

GAGTGCCTTATATCACATAGCCCAAAATGAATCCCCTACACTACAATCTAATGAATG GTCTGATTATTTTCGAAACTTTGTAGATTCTTGCCTCCAGAA

AATCCCTCAAGATCGCCCTACATCAGAGGAACTTTTAAAG - UNI4162 - CACATGTTTGTTCTTCGAGAGCGCCCTGAAACAGTGTTAATAGATCT

TATTCAAAGGACAAAGGATGCAGTAAGAGAGCTGGACAATCTGCAGTATCGAAAGATGAAGAAACTCCTTTTCCAGGAGGCACATAATGGGCCAGCGGTA

GAAGCACAGGAAGAAGAGGAG GAGCAAGATCATGGTGTTGGCCGAACAGGAACAGTGAATAGTGTTGGAAGCAATCAGTCTATCCCTAGTATGTCTATC

AGTGCCAGCAGTCAAAGCAGCAGTGTTAATAGTCTTCCAGATGCATCAGATGACAAGAGTGAGCTAGACATGATGGAGGGAGACCATACAGTGATGTCTA

ACAGTTCTGTCATCCACTTAAAACCT GAGGAGGAAAATTACCAGGAAGAAGGAGATCCTAGAACAAGAGCATCAGACCCACAGTCTCCCCCTCAGGTGT

CTCGTCACAAGTCACATTATCGTAATAGAGAACACTTTGCAACCATACGAACAGCATCACTG GTTACAAGACAGATGCAAGAACATGAGCAGGACTCTG

AACTTAGAGAACAGATGTCTGGTTATAAGCGGATGAGGCGACAGCATCAAAAGCAGCTGATGACGCTGGAAAATAAACTGAAGGCAGAGATGGACGAACA

TCGGCTCAGATTAGACAAAGATCTTGAAACTCAGCGTAACAATTTCGCTGCAGAAATGGAGAAACTTATTAAGAAACACCAAGCTGCTATGGAAAAAGAG

 GCTAAAGTGATGGCCAATGAGGAGAAAAAATTCCAGCAACACATTCAGGCTCAACAGAAAAAAGAACTGAATAGCTTTTTGGAGTCTCAAAAAAGAGAA

TATAAACTTCGCAAAGAGCAGCTTAAGGAG GAGCTGAATGAAAACCAGAGCACACCTAAAAAAGAAAAGCAGGAATGGCTTTCAAAGCAGAAGGAGAAT

ATACAGCATTTTCAGGCAGAAGAAGAAGCTAATCTTCTTCGACGTCAAAGGCAGTATCTAGAGCTAGAATGTCGTCGCTTCAAAAGAAGAATGTTACTTG

GGCGACATAACTTGGAACAGGACCTTGTCAGGGAG GAGTTAAACAAAAGGCAGACTCAAAAGGACTTGGAACATGCAATGCTATTGCGACAGCATGAAT

CAATGCAAGAACTGGAGTTTCGCCATCTCAACACTATTCAGAAGATGCGCTGTGAGTTGATCAGACTGCAGCATCAAACTGAGCTCACTAACCAGCTAGA

GTACAATAAGAGAAGGGAACGGGAACTGAGGCGAAAACATGTCATGGAAGTTCGACAACAACCTAAGAGTCTGAAG TCTAAAGAACTCCAAATAAAAAA

GCAGTTTCAGGATACCTGCAAAATTCAAACCAGACAGTACAAAGCATTAAGGAATCACCTACTGGAGACTACACCAAAGAGTGAGCACAAAGCTGTTTTG

AAAAGACTCAAGGAGGAACAGACTCGAAAGTTAGCCATCTTGGCTGAGCAGTATGATCATAGCATTAATGAAATGCTCTCCACACAAGCT CTGCGTTTG

GATGAAGCACAGGAAGCAGAATGCCAGGTTCTGAAGATGCAGCTGCAGCAGGAACTGGAGCTGCTGAATGCTTATCAGAGCAAAATAAAGATGCAAGCTG

AGGCCCAACATGATCGAGAGCTTCGAGAGCTGGAACAGAGGGTCTCCCTTCGCAGAGCGCTCTTAGAACAAAAG ATTGAAGAAGAGATGTTGGCTTTGC

AGAATGAACGCACAGAACGAATACGTAGCCTGCTCGAGCGTCAAGCCAGAGAAATTGAAGCATTTGACTCTGAAAGCATGAGATTAGGTTTTAGTAACAT

GGTCCTTTCTAATCTCTCCCCTGAGGCATTCAGCCACAGCTACCCAGGAGCTTCTAGTTGGTCTCACAATCCTACTGGGGGTCCAGGACCTCACTGGGGT

CATCCCATGGGTGGCACACCACAAGCTTGGGGTCATCCGATGCAAGGTGGACCCCAACCATGGGGTCATCCCTCAGGGCCAATGCAAGGGGTACCTCGAG

GTAGCAGTATGGGAGTCCGCAATAGCCCCCAGGCTTTGAGGCGGACAGCTTCTGGGGGACGGACGGAACAGGGCATGAGCAGAAGCACGAGTGTCACTTC

ACAAATATCCAATGGGTCACACATGTCTTACACATAATAATTGAAAGTGGCAATTCCTCTGGAGCTGTCTGCCAAAAGAAACTGCCTACAGACATCATCA

CAGCAGCCTCCTCACTTGGGTACTACCGTGTGGAAGCTGTGCATATGGTATATTTTATTTGTCTTTGTAAAGCGTTATGTTTTGTGTTTACTAATTGGGA

TGTCATAGTATTTGGCTGCCGGGGTTTTTGTGGTTGGCTTTTTGTTTTTGTTTAACTTTTGGAAAATTTTTAAAGTGATAATAGATAAGTATTTCATGTA

TGTGGCAAAAAAAAAAAATTGGCTTAATTAGAAGGGGTATTATCTGAACAATATAAAAACAGAATGAAGCAAGCTAATCTGAATCATCACTTTAGGGTAT

CCATAGCCTAAGAAATGTGTCAGAAGATCTAAAGCCTTCCTTCATATTCCAGTTCTGTGAGTCCCTAACAGCAGGCAGCATCCATGCTGAAGCACATACA

CCTCCGCTCCTCACCAGTGGGTTTTCTTTATTTATGAATTGATCTGATTTCTCAACCTCATTTGAACTAAAAAACAAGACCATGAACATTAAAAGATTGC

ATTTACCTTTTCAGTGGTAGAAAATCATTTAGTTCTTTGCTATAAATGATTCAGAATTTTGTCAGATTTTGTAGGTTGTATCATCGTAAGACGGAGTTGC

ATAAGGAGATCATAAGCTGTGTGGCTATTGCACTAACAAGCCTGTGAGCTTTCAGAGGGGAAAAACTAGAGGGCGAGAGGGGCCCCTGAAAGTTCCTGTG

ACAGGGATGCTCAGCAGGGAGGAGGGAAAGCCTGTATAGCTAGCCTGACATTTTGTTTCTTGTACAATATCTCATGTGACCCAAACTTGAGACTCCAAAC

AGTACCTTTGCTTTGTTTGTACAAAAATGAAGACCTATAGCCAACACAAAGCAAATGCCAGAGGTATTGGATGATGCCATATTTGAACTGCCATCTATTA

GCATATTCATCACACTACATAGACATAGTTTTACTGCCCCCTTTTTAGCTCATGGGATTTCCTGTTTACAGGTAGCAATAGTCAATTATTTAACTACTTA

GTTGCCACCAGGAGTCACTGAGCCAATGACTATCAGCTGCTGACTAATCTTCACACTGTAGTTATTGCTTCATTTACAGGTCCTCTGTGCTTAATTGCTG

TTTTTGTTGCTGTAGTACCTTATGAATTCTTAATTCATTGAGACTTAGTGACCATCTGGGTCCATGTTAATATCATATAATAGCAAATTCCTTTCAGAAG

TCTCTAGCTTTAGTGCTAAAATACTACTGAGAAAGGAACTAGGTAGTTTGGTGAATGAAAGAAAACAAAATTTGAAGATATTATGTAGTGGTCAAGGACC

ACTAATATTTGGGGAGTGTGTTTTGTCTGTTCTTCAATGAAGGATCAATCCAGTGTTCTTCATCAATGTTAGTTAATATCCCATTGCTTGTGTGGCGCCT

TGAGTTGGTGGTAGACTAGGGCAAATGCCCTCTTTAGTGAGAGACCAGAGGTTTTGTATAAGTTATTGTCCTGCTCCCTTTTCAGTTGTCTTGAAGAGCT

CTTGCTACTAACTTTGGGTCCTGCTTTTCATTTAGGTAGATGGTAAGCATTCTCTTAATCATAATTAGAACAAACTAGTGACCAAATTGTCATCTGCTAG

TATGGAAGTTCTTAGTTTTCTTAACCATGCTTTATGTCTTGTCCAGGTATGTCAGTCCAGTTTCCATGACGTACCCCCTTCAGAAGTTTCTGACATTGGT

TTGAGGTTTTCTGACACTAATTAAAAGAAAAATTAGATCAGGGTGTGGTAGCAAATGCCTATAATCCCAGCATTTAGGAGGCAGGGATAGGAATCTCAGG

TTCAAGGCTGCCTACAAGTGTCTCAAAAAAGAAAGAACAAAAGAAAGGTAGATGCTATAGTATAGGTCCTTTGAAAATCCAATAGAAGGTTAATAGTATT

CACACACAGGTCTAGGCAGGGTTTTAAACATATTCCCCATCAGTTTTTAGGTTAACATATACTTGCTATAGCTAATGAAAAGGGCTTTTCTTTTTTCTTT

TTCTTTCTCTTTTTTTCCTTTTTCACTCAAAATACTATTAAGGAGTTTCTCAGACAAATTGAAAATTCTATATGTTTTGAGGAAATAAGGGGAAGCTTTA

GAGTTTAATAGGATATTCAAAACTATAAAAGAATATCATCTTAAAAAACTGTTCTGGCAACTATCTGCTACCAGAAGGTTAGATTGAGAAAGCAGATCCA

ATATATGCAAGACATTTCTTCAAACTCCAAACTACTACCAGAAACACATTTTATCACCCATTGTGAGAGTCACTTGGTCAAATTTAGTTAATGAGTCCAT

TTTGATCATAATGCACTCACACTAGTGTGTTTGAATACTGACTGTCTGTCTGTCCAGTAAGGATTTCTGCCCCCATCTAATTGTGTGGCACCCAGTTTTT

CCATGTAGGTCATTATACCTGGATGATAACATCAATTTAGTTACAATGCATGTAGTTTGCACAATGATTAAAATGAATAGGTTTGTGTTTATAGCCTATA

ATAACTCTAGTTGAATCATGTACACAGCAGGAGTGGTCACAGTAAAAACTGGTAGCAGGAAAATTTGAAAGGGTTTGAAATGCCCTGAAATCAGGGCAAG

TACTTAATGGGGAAAAAAAAGCAGAAATGTCAACATTTGACCAAATTAACACTACCTCCTCCCCAGTTGTTGGTATTCATTCATTATATGTGTGTTTAAC

AGGATGAGAGCATGGCGAGCTTGTAGCACACCAGAGGTTGTAGACCTATATCTGGTATCCAGAACCTGACAGGGAAACAGTTCTTGGTCCCCCTTTTTTG

GGGTCAGCATTTTAAAAATGCAAAGCCTATATGTTGAGACATTGTATTCCTAATTAGATTCTCTGTCCTTTGCACATAACTTTCTTTTAAACTTAGTTCT

AACCCTAAATCTTGACATCAGAAAGTGTTTGCACTGTATAAACAATGTTAGCTGAAAGCATGTTTATTTTTTAAGGAGCTCCTGCTCTTCTGCACATTTC

CATATCTAGAGATGGATAGTCCTGAACTTGACGTCACACCCACAGGTGAAACAGCCCGAAGTCAAGGCCTTGCTAGTAAATGGAGCTTTGTACATAGTCA

TTGTGATGTCTTGGCTGCCCGGACACCACGTAAACATAACACTAAAGAAACTGTCCTGGAGATCCCATCCTGCTACTAAGAAGTTTTCTGTACATCACTT

CCAAACATTGGAAACTTTCAGATCATAAGGCAGAATTTAGTAATTTTGTGCTTCTGTTAATGTCTAGCATTTTAAACATAGGATAACATTGTTTTGGACA

CTGGAATAATATGATTTATTTTCACCTGTAAAAATGACTTCATTGTACTTGAACACCTTTGCATTTCTCCATTTGTGCCATTTACAAGTGGAAATAAATT

TTATTATACCATGATCTACTGGCGTTTTAAAACTGTTAAATGTGCACATTTTGGGTATAGCTATTTTCACTTGTATGTATATATTGTATATACATATAAG

TGTCTGTATGTGTGTATAGATGGATTGGTATAACTCATTCTAAACGTGTCTGCCAGGGCTCAAGTTTTATTGTTCTTGCCCCACTCCCACCCCATGTTAC

AGCAAGACTGGTCTTACAGAGTGAGTACTCTGGGTGATGCTTACGGGAAGGAGATTGGTAGATGCAGTCTTTTTTTCCCCCTTAGCACTTGTATGAGTGA

GGAGAAAGTTAGGTAAAGATTGAAACTATAAATTACAGTGCAGTAAACTGTGCTAGGGAAGGAATCAGTTACTATTTAAGTTTGTTTTACAATGCAATAA

AAGATACAAGCTGCAGAGAAAAGTAAACTCTGCAAAGAACACTGGTAATAATTGTTCTGCAAAGGTTAAGAAAGCCACTGAGTCACAGTCTTCATGGACT

TTTGGGGTTTCTTAGTGTTGGATTTTTGGGGTTTCTCATTTACTTTTTACTCTTAATACTAATGCTTATGTGTTTCACTGAGTATCAAAACTGCCAAGAA

GGGTAACTAAGGTTCCTAAACTGTAAGATGAGCAGGAGATGATCACTGGGAGAGAAAGCATACTGGATTGAAGGAAGGGCTGTCTCCTTTTAACTTCTTG

TTGATAGTTGCAAGTTCTTTATGCACCTTCTACCCCTTCTGAGCCACTACTATTCAAGCAGAGATTTTGTCTAATAGAACATGCCTTTCTTGCTTTTGCT

TCTTTTCTTTTGAGACATGTACCCTTTCTGATTGGATAATTGATGTTTAGCCAAGGCTGGCCTCAAAATACTAGTAATCTTTCTGTAAGCCTCTCAAGTA

CTGGGATTACAGGCATGAACCACCATGCCTATAGCCACAGCAACCCATTCTTTTGGAGGTTTTATAGTTCTCCATTTGTCTCATGTTCCGAATGTGAAGT

GTCCTAATGTGTATTAAAGTCAGAAAATAATATATTTAAGGTATACTAAGTATGAATCTGCTATGATAAAAGAAATTCTCACTTCTCAAATAGTCTTCTT

GTAAGGAGCATTGGGCTGTCATCTTTGAGCTGCTTATCAAAATACAGATCATTATTGCATATATGCAAATTCTGTTTTATTTTATCCCTAATAACAGAAG

TCTCCCTTCCATGGTTTTAGCGTTGCCTTTTTAAAAAGGCACTCACCCTGAGTTGTTAAGAACTGGACCTGCCCCACCCTCAGATTCCTTAAAGGATGAA

GAGTGTGCTGTACACTCAGCATATGTGCCTCTTGTATGCAAGGACTACTGATTGAAGTCTGTTTTGCTGTGTCTGGTTATGTTGTCTGCACTTTTATGAA

ATCACTACAATAGATCTACGTTGGAAATAACTATCAATTTGTAAAGAAATTTTTATTAAACACTGTAGAAAAAGTGAAGCTGAGAACTCTTTTGTGCATT

TATATTTCCTACTGAATTCTGGTAGCCCACTTTTAACATTGTATTGACTTTTTTTTTTTTTTTTTGATTATATTCAGATTTCCAAACAAGTGCTGGCCTT

CAGATCATAAGTATAAGAAATATGCATCATATCTGCCTATTGCAGGCTTCTGAAACTTGCACTGCCCATCCATGCAAAAATAAGTATCTTAAATAAAAGC

AGAGAGCAAAAACTGGGGAGCCATGTACTATGTCACCACATCTGTTAACTGTTTCCTGCAATCTAAACTGAAGTGTGTGTGTGGGTGTGTGTATGTGTAT

TGGGGGTTTTGTTTTGCTTTGCTTTTAAATATACAAGGGGTTCTTCTTTAAATAGAGGAAAAGGTTAATCCTCTCCAGCAGGATGCCCACTGGATATATT

AACATCTGTAGGTAGTTGGAAGTGTAGAGAGAAGAGAAGGTAAGACTTCTCAGTGAATGGAAGGATGTCTTGATGCTCAAGAGTCCCCGCCCCCAAAGTA

CGGGTAATTCAGCCTGCACAGTTTCCTTTCACTCATAGTTTCACAATTACGAGTGAAAAATCATGTAATTATCTGTAAATATGTAGCTAACAAATTGACC

TAGTTTCTGTACTTTTTTGGTTTTGTACTAAAGTTTATAGGTCTGTGCCAGCTAGAGAGGAGTTGCTGTCATTGCTAGTCGTGCTCTAGCATACAACCCT

GAAACCATCCTAGGTGACATTTTAGAATTAATACTTAAGTGTTGTTAAATGGGGACATGGAGCTTAATCATTGGTCAGGTTTGAAGTCTTTTGAAGCTAA

GTAATTTTATTTAATATGATTACATGTCGTCAGTCATGAGTGAGGTGTAGGGAGTCTCCCTCCCCAAGTGGCCATGTTTACAGAGTGTTGTCTACAAAGT

GCAAGTGTGTTAATGTTTATGTAAATTATGCAGGTGATAACTTTATGGTTTGGGACTGTTTATGGGCTCTTTTAAGTGAATTTTCAAATGAAATGAACTA

TGCTTATTGCTGGCACATTGATCCCATTTCTGGAACATTTCCTACTTCCAGAATTCCGTATGTTCCTTAGACATTACCCCCACTTAACCTCCCTTCCTCT

GATATGCCTTGTAGCTAAGATTTAAAAGACTGTTGAACATAGATGAGGGGTATGCATTTCTTAAAAATCCATGAACCCTCAATTGTATGCTTTCAGTATT

GTGTTATATGTTTCTATGGCAACTTTGAAGTCAGTGGTTTAGAAATGAGATACCAATGTTAATGAAAAGTATGTACTCTTTGCTTTTGCATGGCTTGGCT

TAGTATCCAAGGTATATTAGAGCCACTTGAAAGCATGAAGACCAGTTATATGGAAACAGGTTTCTCTCAGTGGCACATTTTGCTTTTTCTTAGCCCTCAA

ATACATTGCCTCGGCATGAACATTATTGTTAATATAAATTGCACATGGTCATCGAGTGAATTATAAAATTTTGAAAAGATGCAGCTGCCCAATATTAACA

GTTTTAGTTGGTCTCTATCTCAAATAACAGTGTAGGTATTGGAACCCTTGTAGCCCTTTTGGGGGTCAAACAGGTATATGGATTTATCAAGGAGGGCATT

GGCTGCCCCTGGGGTATTGCCACGCTGTTGTCTTGCTGCCCATTCACTCCATGTGCTGCTGTCCTTCCTTCACTTCATACTCTCAAAGAAACCATCACCC

TTTCTTCCTATTTTTTTTTGTCTTTTATTCCACATTAAATGGGAATTGTGCCTATTTAGATTGCCCCTCCAGTTAAATACACATGTAATCCAAGCCAGAG

ATAAGATGGAAGAACATTTTTTTTTCAAGTTCACTTGGCCAGTAACTTATCTAACAAACTGTTTTACCACACTATCTTGACACTTGATAGAAGAGCCTAT

TAGGAGTCACAGTGGTTTCGTAGAGTAAAACCCAAGTGAGGAGGGATGTGTGGGGTTTCCATTAGGAAATAATTTCGTTCTTGGTTTACTCTTTAAGATC

CTTCTCTGCTAGTTTAGAATAGGTTAATTTTTTTTTAATTTTTTTAGGGAAATTTTTACAAAAATAATGGTCTGATGTAAATACCATTTTAAAGTACAGT

GCACATAACTCCCTAGGCTGTTCCAACCTGACTATTTGTAAATGCTTTAGAGTTTTAAATTAACACTTCTGTTGCTAAATACTATTTATGTAAGTCTGAA

AAGGTTTTTAACCCATATAAAACATTTAAATAATGCAGGTTATTATGAGCAAGTTAGCTTTGAGAACCCTCCTTTTAGTATATGAAAAAGCCTAATGCGC

ATTCATGAGGTTGGAGAGACTATGAGAAATATGTATAGTGTATATTTTAAACAGCTTTGCTTGTATTGTGAAGATTTAAGAACAAACTTGAGATTTTTAA

AGTTAACTATTAACACAGTTTTAACATAAGTTATCCCACTGGGTTTAAAAGCATCTTGAATGTATAACCCTTCTGTAACCCAGGCTGGTCTTTGCTTTTA

CTGAACATCCAAACGTTATTTATATTTTAATTTTATGTACTCATTTCTTTTTGTTTTCCTCAAACAGCATGTTGTTGTTGGGGTGTTTTGTTTTGTTTTT

GTTTGTTTTGGGTTTTTTTTTTTTTTTGCACATGTAGAAATTTTTTAAAAGAAGGAAATTAAGACATGATTTTTCTCTAGATTTTCTTCACTTCAGTCTT

TCTACTAACCTCGTAAAAACCATGGCTTCCATTTGCTTTATTTGTGCAAATGCCAGGGTTGGTTTTTATTTTTATTTTTGCTATTTACCTAAAAAGAAAA

AGAGACAATGCTTCAGTCAACTGCTTTTTTATTTAAAATTTAAAGAAAAAAAAAAGAAAAAAAAAGCTGTAACCTTATCATTTCTGAGTAGACCATTAAG

AGAAATGCACACCTGTCAGCCCAGGACCAGCTTTGGTGGCTAAAGGGAATATTTTAACTCGCAAGGTGATGTTCTGTACAAAACGTGGTATATGTTACCC

ACAGTCCATTTCAGTTATTCCCACAAGTCAGGTCCAGATAAATGAGGGTTATCAGCTAACTGATATGTTATCATTGAGGTTCGTCAATGAATTTGTACAT

TTCTAGTTCCCTTTGGTGAAGGGAAAAATGATTTTGCAAGACCTAGATTTTGGCTTGGTTTCTTGCCTCCTTTTTTGGCAGCCTTCATCTTTTCCTAAAG

CCCTTGAGCCTGTAGGGTTTTCATAGTGGACAAAGGACTTAAATGGTCTTTTAAAACTGGGATAGTTTTTGGGGAAAGGGCAAAAGATTATCATATTGAA

CATGTAGTATCCCAATACTCTCAACAGTGGATAATTATGAGTAAACCCGGTCCTTTCGATGTTTAGAGTAAGCAGAGGCCCACAGTGGAGGCTTACCAAA

GGTTGCAATGAGGAAGAGGCCTCTCCCTCACTGTCAGCACCAGCTGGTAAAGGTGACTGTGCAGATGTGCATTTTCCTTTTGGTAGAAATGGTCCACAGC

ACTAACTGGTAAGGCTTATTGTACAGTATATTGTCAGTATTCTTCTGGTTCAGCATACCTTATAGTTCGTATATAACCTGTATTAATTGTATAGATTGTG

CATTTAAAGCTGTTACCAAGTTGTCAGAACCCTAAGAATGAAAACAGGTCATATGTAATATTTTGTTTGTAAGTATCCTTTGTATCATAGCAAAGGAAAT

GTTTAAAAGATCAACTGTAATAAAAGTAATTTTAGTACACAG
Translation
 - UNI4684 - - UNI14534 - - UNI19584 - MPSTNRAGSLKDPEIAELFFKEDPEKLFTDLREIGHGSFGAVYF - UNI4684 - - UN

I14534 - ARDVRTNEVVAIKKMSYSGKQSTE - UNI14534 - KWQDIIKEVKFLQRIKHPNSIEYKGCYLREHTAW - UNI23588 - LVMEY

CLGSASDLLEV VHKKPLQEVEIAAITHGALQGLAYLHSHTMIHR - UNI27162 - RDIKAGNILLTEPGQVKLADFGSASMASPANSFVGTPYW W

MAPEVILAMDEGQYDGKVDVWSLGITCIELA AERKPPLFNMNAMSALYHIAQNESPTLQSNEW WSDYFRNFVDSCLQKIPQDRPTSEELLK - UNI4

162 - HMFVLRERPETVLIDLIQRTKDAVRELDNLQYRKMKKLLFQEAHNGPAVEAQEEEE EQDHGVGRTGTVNSVGSNQSIPSMSISASSQSSSVNS

LPDASDDKSELDMMEGDHTVMSNSSVIHLKP EEENYQEEGDPRTRASDPQSPPQVSRHKSHYRNREHFATIRTASL VTRQMQEHEQDSELREQMSGYK

RMRRQHQKQLMTLENKLKAEMDEHRLRLDKDLETQRNNFAAEMEKLIKKHQAAMEKE AKVMANEEKKFQQHIQAQQKKELNSFLESQKREYKLRKEQLK

E ELNENQSTPKKEKQEWLSKQKENIQHFQAEEEANLLRRQRQYLELECRRFKRRMLLGRHNLEQDLVRE ELNKRQTQKDLEHAMLLRQHESMQELEFR

HLNTIQKMRCELIRLQHQTELTNQLEYNKRRERELRRKHVMEVRQQPKSLK SKELQIKKQFQDTCKIQTRQYKALRNHLLETTPKSEHKAVLKRLKEEQ

TRKLAILAEQYDHSINEMLSTQA LRLDEAQEAECQVLKMQLQQELELLNAYQSKIKMQAEAQHDRELRELEQRVSLRRALLEQK IEEEMLALQNERTE

RIRSLLERQAREIEAFDSESMRLGFSNMVLSNLSPEAFSHSYPGASSWSHNPTGGPGPHWGHPMGGTPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGV

RNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSHMSYT
Transcript ENSMUST00000017435
Sequence
TTATTTTCCTAGTTTATGCCAGCGTGGCTTCATTCATACAGATGAACCAAGCATTGGGATAGCAGTATAAAATTAGAATCAGACAGCTGACTGCTCAGCA

GGATGCCATCAACTAACAGAGCAGGCAGTCTAAAGGACCCTGAAATTGCAGAGCTCTTCTTCAAAGAAGATCCGGAAAAGCTCTTCACAGATCTCAGAGA

AATCGGCCATGGGAGCTTTGGAGCAGTATATTTT - UNI4684 - - UNI14534 - GCACGAGATGTGCGTACTAATGAAGTGGTGGCCATCAAGA

AAATGTCTTATAGTGGAAAGCAGTCTACTGAG - UNI14534 - AAATGGCAGGATATTATTAAGGAAGTCAAGTTTCTACAAAGAATAAAACATCCC

AACAGTATAGAATACAAAGGCTGCTATTTACGTGAACACACAGCATGG - UNI23588 - CTTGTAATGGAATATTGTTTAGGATCTGCTTCAGATTT

ATTAGAAG TTCATAAAAAGCCATTACAAGAAGTGGAAATAGCAGCAATTACACATGGTGCTCTCCAGGGACTAGCTTATTTACATTCTCATACCATGAT

CCATAG - UNI27162 - AGATATCAAAGCAGGAAATATCCTTCTGACAGAACCAGGCCAAGTGAAACTTGCTGACTTTGGATCTGCTTCCATGGCTT

CCCCTGCCAATTCTTTTGTGGGAACACCATATTG GATGGCCCCAGAAGTAATTTTAGCCATGGATGAAGGACAGTATGATGGCAAAGTTGATGTATGGT

CTCTTGGAATAACGTGTATTGAATTAG CCGAGAGGAAGCCTCCTTTATTTAATATGAATGCAATGAGTGCCTTATATCACATAGCCCAAAATGAATCCC

CTACACTACAATCTAATGAATG GTCTGATTATTTTCGAAACTTTGTAGATTCTTGCCTCCAGAAAATCCCTCAAGATCGCCCTACATCAGAGGAACTTT

TAAAG - UNI4162 - CACATGTTTGTTCTTCGAGAGCGCCCTGAAACAGTGTTAATAGATCTTATTCAAAGGACAAAGGATGCAGTAAGAGAGCTGG

ACAATCTGCAGTATCGAAAGATGAAGAAACTCCTTTTCCAGGAGGCACATAATGGGCCAGCGGTAGAAGCACAGGAAGAAGAGGAG GAGCAAGATCATG

GTGTTGGCCGAACAGGAACAGTGAATAGTGTTGGAAGCAATCAGTCTATCCCTAGTATGTCTATCAGTGCCAGCAGTCAAAGCAGCAGTGTTAATAGTCT

TCCAGATGCATCAGATGACAAGAGTGAGCTAGACATGATGGAGGGAGACCATACAGTGATGTCTAACAGTTCTGTCATCCACTTAAAACCT GAGGAGGA

AAATTACCAGGAAGAAGGAGATCCTAGAACAAGAGCATCAGACCCACAGTCTCCCCCTCAGGTGTCTCGTCACAAGTCACATTATCGTAATAGAGAACAC

TTTGCAACCATACGAACAGCATCACTG GTTACAAGACAGATGCAAGAACATGAGCAGGACTCTGAACTTAGAGAACAGATGTCTGGTTATAAGCGGATG

AGGCGACAGCATCAAAAGCAGCTGATGACGCTGGAAAATAAACTGAAGGCAGAGATGGACGAACATCGGCTCAGATTAGACAAAGATCTTGAAACTCAGC

GTAACAATTTCGCTGCAGAAATGGAGAAACTTATTAAGAAACACCAAGCTGCTATGGAAAAAGAG GCTAAAGTGATGGCCAATGAGGAGAAAAAATTCC

AGCAACACATTCAGGCTCAACAGAAAAAAGAACTGAATAGCTTTTTGGAGTCTCAAAAAAGAGAATATAAACTTCGCAAAGAGCAGCTTAAGGAG GAGC

TGAATGAAAACCAGAGCACACCTAAAAAAGAAAAGCAGGAATGGCTTTCAAAGCAGAAGGAGAATATACAGCATTTTCAGGCAGAAGAAGAAGCTAATCT

TCTTCGACGTCAAAGGCAGTATCTAGAGCTAGAATGTCGTCGCTTCAAAAGAAGAATGTTACTTGGGCGACATAACTTGGAACAGGACCTTGTCAGGGAG

 GAGTTAAACAAAAGGCAGACTCAAAAGGACTTGGAACATGCAATGCTATTGCGACAGCATGAATCAATGCAAGAACTGGAGTTTCGCCATCTCAACACT

ATTCAGAAGATGCGCTGTGAGTTGATCAGACTGCAGCATCAAACTGAGCTCACTAACCAGCTAGAGTACAATAAGAGAAGGGAACGGGAACTGAGGCGAA

AACATGTCATGGAAGTTCGACAACAACCTAAGAGTCTGAAG TCTAAAGAACTCCAAATAAAAAAGCAGTTTCAGGATACCTGCAAAATTCAAACCAGAC

AGTACAAAGCATTAAGGAATCACCTACTGGAGACTACACCAAAGAGTGAGCACAAAGCTGTTTTGAAAAGACTCAAGGAGGAACAGACTCGAAAGTTAGC

CATCTTGGCTGAGCAGTATGATCATAGCATTAATGAAATGCTCTCCACACAAGCT CTGCGTTTGGATGAAGCACAGGAAGCAGAATGCCAGGTTCTGAA

GATGCAGCTGCAGCAGGAACTGGAGCTGCTGAATGCTTATCAGAGCAAAATAAAGATGCAAGCTGAGGCCCAACATGATCGAGAGCTTCGAGAGCTGGAA

CAGAGGGTCTCCCTTCGCAGAGCGCTCTTAGAACAAAAG ATTGAAGAAGAGATGTTGGCTTTGCAGAATGAACGCACAGAACGAATACGTAGCCTGCTC

GAGCGTCAAGCCAGAGAAATTGAAGCATTTGACTCTGAAAGCATGAGATTAGGTTTTAGTAACATGGTCCTTTCTAATCTCTCCCCTGAGGCATTCAGCC

ACAGCTACCCAGGAGCTTCTAGTTGGTCTCACAATCCTACTGGGGGTCCAGGACCTCACTGGGGTCATCCCATGGGTGGCACACCACAAGCTTGGGGTCA

TCCGATGCAAGGTGGACCCCAACCATGGGGTCATCCCTCAGGGCCAATGCAAGGGGTACCTCGAGGTAGCAGTATGGGAGTCCGCAATAGCCCCCAGGCT

TTGAGGCGGACAGCTTCTGGGGGACGGACGGAACAGGGCATGAGCAGAAGCACGAGTGTCACTTCACAAATATCCAATGGGTCACACATGTCTTACACAT

AATAATTGAAAGTGGCAATTCCTCTGGAGCTGTCTGCCAAAAGAAACTGCCTACAGACATCATCACAGCAGCCTCCTCACTTGGGTACTACCGTGTGGAA

GCTGTGCATATGGTATATTTTATTTGTCTTTGTAAAGCGTTATGTTTTGTGTTTACTAATTGGGATGTCATAGTATTTGGCTGCCGGGGTTTTTGTGGTT

GGCTTTTTGTTTTTGTTTAACTTTTGGAAAATTTTTAAAGTGATAATAGATAAGTATTTCATGTATGTGGCAAAAAAAAAAAATTGGCTTAATTAGAAGG

GGTATTATCTGAACAATATAAAAACAGAATGAAGCAAGCTAATCTGAATCATCACTTTAGGGTATCCATAGCCTAAGAAATGTGTCAGAAGATCTAAAGC

CTTCCTTCATATTCCAGTTCTGTGAGTCCCTAACAGCAGGCAGCATCCATGCTGAAGCACATACACCTCCGCTCCTCACCAGTGGGTTTTCTTTATTTAT

GAATTGATCTGATTTCTCAACCTCATTTGAACTAAAAAACAAGACCATGAACATTAAAAGATTGCATTTACCTTTTCAGTGGTAGAAAATCATTTAGTTC

TTTGCTATAAATGATTCAGAATTTTGTCAGATTTTGTAGGTTGTATCATCGTAAGACGGAGTTGCATAAGGAGATCATAAGCTGTGTGGCTATTGCACTA

ACAAGCCTGTGAGCTTTCAGAGGGGAAAAACTAGAGGGCGAGAGGGGCCCCTGAAAGTTCCTGTGACAGGGATGCTCAGCAGGGAGGAGGGAAAGCCTGT

ATAGCTAGCCTGACATTTTGTTTCTTGTACAATATCTCATGTGACCCAAACTTGAGACTCCAAACAGTACCTTTGCTTTGTTTGTACAAAAATGAAGACC

TATAGCCAACACAAAGCAAATGCCAGAGGTATTGGATGATGCCATATTTGAACTGCCATCTATTAGCATATTCATCACACTACATAGACATAGTTTTACT

GCCCCCTTTTTAGCTCATGGGATTTCCTGTTTACAGGTAGCAATAGTCAATTATTTAACTACTTAGTTGCCACCAGGAGTCACTGAGCCAATGACTATCA

GCTGCTGACTAATCTTCACACTGTAGTTATTGCTTCATTTACAGGTCCTCTGTGCTTAATTGCTGTTTTTGTTGCTGTAGTACCTTATGAATTCTTAATT

CATTGAGACTTAGTGACCATCTGGGTCCATGTTAATATCATATAATAGCAAATTCCTTTCAGAAGTCTCTAGCTTTAGTGCTAAAATACTACTGAGAAAG

GAACTAGGTAGTTTGGTGAATGAAAGAAAACAAAATTTGAAGATATTATGTAGTGGTCAAGGACCACTAATATTTGGGGAGTGTGTTTTGTCTGTTCTTC

AATGAAGGATCAATCCAGTGTTCTTCATCAATGTTAGTTAATATCCCATTGCTTGTGTGGCGCCTTGAGTTGGTGGTAGACTAGGGCAAATGCCCTCTTT

AGTGAGAGACCAGAGGTTTTGTATAAGTTATTGTCCTGCTCCCTTTTCAGTTGTCTTGAAGAGCTCTTGCTACTAACTTTGGGTCCTGCTTTTCATTTAG

GTAGATGGTAAGCATTCTCTTAATCATAATTAGAACAAACTAGTGACCAAATTGTCATCTGCTAGTATGGAAGTTCTTAGTTTTCTTAACCATGCTTTAT

GTCTTGTCCAGGTATGTCAGTCCAGTTTCCATGACGTACCCCCTTCAGAAGTTTCTGACATTGGTTTGAGGTTTTCTGACACTAATTAAAAGAAAAATTA

GATCAGGGTGTGGTAGCAAATGCCTATAATCCCAGCATTTAGGAGGCAGGGATAGGAATCTCAGGTTCAAGGCTGCCTACAAGTGTCTCAAAAAAGAAAG

AACAAAAGAAAGGTAGATGCTATAGTATAGGTCCTTTGAAAATCCAATAGAAGGTTAATAGTATTCACACACAGGTCTAGGCAGGGTTTTAAACATATTC

CCCATCAGTTTTTAGGTTAACATATACTTGCTATAGCTAATGAAAAGGGCTTTTCTTTTTTCTTTTTCTTTCTCTTTTTTTCCTTTTTCACTCAAAATAC

TATTAAGGAGTTTCTCAGACAAATTGAAAATTCTATATGTTTTGAGGAAATAAGGGGAAGCTTTAGAGTTTAATAGGATATTCAAAACTATAAAAGAATA

TCATCTTAAAAAACTGTTCTGGCAACTATCTGCTACCAGAAGGTTAGATTGAGAAAGCAGATCCAATATATGCAAGACATTTCTTCAAACTCCAAACTAC

TACCAGAAACACATTTTATCACCCATTGTGAGAGTCACTTGGTCAAATTTAGTTAATGAGTCCATTTTGATCATAATGCACTCACACTAGTGTGTTTGAA

TACTGACTGTCTGTCTGTCCAGTAAGGATTTCTGCCCCCATCTAATTGTGTGGCACCCAGTTTTTCCATGTAGGTCATTATACCTGGATGATAACATCAA

TTTAGTTACAATGCATGTAGTTTGCACAATGATTAAAATGAATAGGTTTGTGTTTATAGCCTATAATAACTCTAGTTGAATCATGTACACAGCAGGAGTG

GTCACAGTAAAAACTGGTAGCAGGAAAATTTGAAAGGGTTTGAAATGCCCTGAAATCAGGGCAAGTACTTAATGGGGAAAAAAAAGCAGAAATGTCAACA

TTTGACCAAATTAACACTACCTCCTCCCCAGTTGTTGGTATTCATTCATTATATGTGTGTTTAACAGGATGAGAGCATGGCGAGCTTGTAGCACACCAGA

GGTTGTAGACCTATATCTGGTATCCAGAACCTGACAGGGAAACAGTTCTTGGTCCCCCTTTTTTGGGGTCAGCATTTTAAAAATGCAAAGCCTATATGTT

GAGACATTGTATTCCTAATTAGATTCTCTGTCCTTTGCACATAACTTTCTTTTAAACTTAGTTCTAACCCTAAATCTTGACATCAGAAAGTGTTTGCACT

GTATAAACAATGTTAGCTGAAAGCATGTTTATTTTTTAAGGAGCTCCTGCTCTTCTGCACATTTCCATATCTAGAGATGGATAGTCCTGAACTTGACGTC

ACACCCACAGGTGAAACAGCCCGAAGTCAAGGCCTTGCTAGTAAATGGAGCTTTGTACATAGTCATTGTGATGTCTTGGCTGCCCGGACACCACGTAAAC

ATAACACTAAAGAAACTGTCCTGGAGATCCCATCCTGCTACTAAGAAGTTTTCTGTACATCACTTCCAAACATTGGAAACTTTCAGATCATAAGGCAGAA

TTTAGTAATTTTGTGCTTCTGTTAATGTCTAGCATTTTAAACATAGGATAACATTGTTTTGGACACTGGAATAATATGATTTATTTTCACCTGTAAAAAT

GACTTCATTGTACTTGAACACCTTTGCATTTCTCCATTTGTGCCATTTACAAGTGGAAATAAATTTTATTATACCATGATCTACTGGCGTTTTAAAACTG

TTAAATGTGCACATTTTGGGTATAGCTATTTTCACTTGTATGTATATATTGTATATACATATAAGTGTCTGTATGTGTGTATAGATGGATTGGTATAACT

CATTCTAAACGTGTCTGCCAGGGCTCAAGTTTTATTGTTCTTGCCCCACTCCCACCCCATGTTACAGCAAGACTGGTCTTACAGAGTGAGTACTCTGGGT

GATGCTTACGGGAAGGAGATTGGTAGATGCAGTCTTTTTTTCCCCCTTAGCACTTGTATGAGTGAGGAGAAAGTTAGGTAAAGATTGAAACTATAAATTA

CAGTGCAGTAAACTGTGCTAGGGAAGGAATCAGTTACTATTTAAGTTTGTTTTACAATGCAATAAAAGATACAAGCTGCAGAGAAAAGTAAACTCTGCAA

AGAACACTGGTAATAATTGTTCTGCAAAGGTTAAGAAAGCCACTGAGTCACAGTCTTCATGGACTTTTGGGGTTTCTTAGTGTTGGATTTTTGGGGTTTC

TCATTTACTTTTTACTCTTAATACTAATGCTTATGTGTTTCACTGAGTATCAAAACTGCCAAGAAGGGTAACTAAGGTTCCTAAACTGTAAGATGAGCAG

GAGATGATCACTGGGAGAGAAAGCATACTGGATTGAAGGAAGGGCTGTCTCCTTTTAACTTCTTGTTGATAGTTGCAAGTTCTTTATGCACCTTCTACCC

CTTCTGAGCCACTACTATTCAAGCAGAGATTTTGTCTAATAGAACATGCCTTTCTTGCTTTTGCTTCTTTTCTTTTGAGACATGTACCCTTTCTGATTGG

ATAATTGATGTTTAGCCAAGGCTGGCCTCAAAATACTAGTAATCTTTCTGTAAGCCTCTCAAGTACTGGGATTACAGGCATGAACCACCATGCCTATAGC

CACAGCAACCCATTCTTTTGGAGGTTTTATAGTTCTCCATTTGTCTCATGTTCCGAATGTGAAGTGTCCTAATGTGTATTAAAGTCAGAAAATAATATAT

TTAAGGTATACTAAGTATGAATCTGCTATGATAAAAGAAATTCTCACTTCTCAAATAGTCTTCTTGTAAGGAGCATTGGGCTGTCATCTTTGAGCTGCTT

ATCAAAATACAGATCATTATTGCATATATGCAAATTCTGTTTTATTTTATCCCTAATAACAGAAGTCTCCCTTCCATGGTTTTAGCGTTGCCTTTTTAAA

AAGGCACTCACCCTGAGTTGTTAAGAACTGGACCTGCCCCACCCTCAGATTCCTTAAAGGATGAAGAGTGTGCTGTACACTCAGCATATGTGCCTCTTGT

ATGCAAGGACTACTGATTGAAGTCTGTTTTGCTGTGTCTGGTTATGTTGTCTGCACTTTTATGAAATCACTACAATAGATCTACGTTGGAAATAACTATC

AATTTGTAAAGAAATTTTTATTAAACACTGTAGAAAAAGTGAAGCTGAGAACTCTTTTGTGCATTTATATTTCCTACTGAATTCTGGTAGCCCACTTTTA

ACATTGTATTGACTTTTTTTTTTTTTTTTTGATTATATTCAGATTTCCAAACAAGTGCTGGCCTTCAGATCATAAGTATAAGAAATATGCATCATATCTG

CCTATTGCAGGCTTCTGAAACTTGCACTGCCCATCCATGCAAAAATAAGTATCTTAAATAAAAGCAGAGAGCAAAAACTGGGGAGCCATGTACTATGTCA

CCACATCTGTTAACTGTTTCCTGCAATCTAAACTGAAGTGTGTGTGTGGGTGTGTGTATGTGTATTGGGGGTTTTGTTTTGCTTTGCTTTTAAATATACA

AGGGGTTCTTCTTTAAATAGAGGAAAAGGTTAATCCTCTCCAGCAGGATGCCCACTGGATATATTAACATCTGTAGGTAGTTGGAAGTGTAGAGAGAAGA

GAAGGTAAGACTTCTCAGTGAATGGAAGGATGTCTTGATGCTCAAGAGTCCCCGCCCCCAAAGTACGGGTAATTCAGCCTGCACAGTTTCCTTTCACTCA

TAGTTTCACAATTACGAGTGAAAAATCATGTAATTATCTGTAAATATGTAGCTAACAAATTGACCTAGTTTCTGTACTTTTTTGGTTTTGTACTAAAGTT

TATAGGTCTGTGCCAGCTAGAGAGGAGTTGCTGTCATTGCTAGTCGTGCTCTAGCATACAACCCTGAAACCATCCTAGGTGACATTTTAGAATTAATACT

TAAGTGTTGTTAAATGGGGACATGGAGCTTAATCATTGGTCAGGTTTGAAGTCTTTTGAAGCTAAGTAATTTTATTTAATATGATTACATGTCGTCAGTC

ATGAGTGAGGTGTAGGGAGTCTCCCTCCCCAAGTGGCCATGTTTACAGAGTGTTGTCTACAAAGTGCAAGTGTGTTAATGTTTATGTAAATTATGCAGGT

GATAACTTTATGGTTTGGGACTGTTTATGGGCTCTTTTAAGTGAATTTTCAAATGAAATGAACTATGCTTATTGCTGGCACATTGATCCCATTTCTGGAA

CATTTCCTACTTCCAGAATTCCGTATGTTCCTTAGACATTACCCCCACTTAACCTCCCTTCCTCTGATATGCCTTGTAGCTAAGATTTAAAAGACTGTTG

AACATAGATGAGGGGTATGCATTTCTTAAAAATCCATGAACCCTCAATTGTATGCTTTCAGTATTGTGTTATATGTTTCTATGGCAACTTTGAAGTCAGT

GGTTTAGAAATGAGATACCAATGTTAATGAAAAGTATGTACTCTTTGCTTTTGCATGGCTTGGCTTAGTATCCAAGGTATATTAGAGCCACTTGAAAGCA

TGAAGACCAGTTATATGGAAACAGGTTTCTCTCAGTGGCACATTTTGCTTTTTCTTAGCCCTCAAATACATTGCCTCGGCATGAACATTATTGTTAATAT

AAATTGCACATGGTCATCGAGTGAATTATAAAATTTTGAAAAGATGCAGCTGCCCAATATTAACAGTTTTAGTTGGTCTCTATCTCAAATAACAGTGTAG

GTATTGGAACCCTTGTAGCCCTTTTGGGGGTCAAACAGGTATATGGATTTATCAAGGAGGGCATTGGCTGCCCCTGGGGTATTGCCACGCTGTTGTCTTG

CTGCCCATTCACTCCATGTGCTGCTGTCCTTCCTTCACTTCATACTCTCAAAGAAACCATCACCCTTTCTTCCTATTTTTTTTTGTCTTTTATTCCACAT

TAAATGGGAATTGTGCCTATTTAGATTGCCCCTCCAGTTAAATACACATGTAATCCAAGCCAGAGATAAGATGGAAGAACATTTTTTTTTCAAGTTCACT

TGGCCAGTAACTTATCTAACAAACTGTTTTACCACACTATCTTGACACTTGATAGAAGAGCCTATTAGGAGTCACAGTGGTTTCGTAGAGTAAAACCCAA

GTGAGGAGGGATGTGTGGGGTTTCCATTAGGAAATAATTTCGTTCTTGGTTTACTCTTTAAGATCCTTCTCTGCTAGTTTAGAATAGGTTAATTTTTTTT

TAATTTTTTTAGGGAAATTTTTACAAAAATAATGGTCTGATGTAAATACCATTTTAAAGTACAGTGCACATAACTCCCTAGGCTGTTCCAACCTGACTAT

TTGTAAATGCTTTAGAGTTTTAAATTAACACTTCTGTTGCTAAATACTATTTATGTAAGTCTGAAAAGGTTTTTAACCCATATAAAACATTTAAATAATG

CAGGTTATTATGAGCAAGTTAGCTTTGAGAACCCTCCTTTTAGTATATGAAAAAGCCTAATGCGCATTCATGAGGTTGGAGAGACTATGAGAAATATGTA

TAGTGTATATTTTAAACAGCTTTGCTTGTATTGTGAAGATTTAAGAACAAACTTGAGATTTTTAAAGTTAACTATTAACACAGTTTTAACATAAGTTATC

CCACTGGGTTTAAAAGCATCTTGAATGTATAACCCTTCTGTAACCCAGGCTGGTCTTTGCTTTTACTGAACATCCAAACGTTATTTATATTTTAATTTTA

TGTACTCATTTCTTTTTGTTTTCCTCAAACAGCATGTTGTTGTTGGGGTGTTTTGTTTTGTTTTTGTTTGTTTTGGGTTTTTTTTTTTTTTTGCACATGT

AGAAATTTTTTAAAAGAAGGAAATTAAGACATGATTTTTCTCTAGATTTTCTTCACTTCAGTCTTTCTACTAACCTCGTAAAAACCATGGCTTCCATTTG

CTTTATTTGTGCAAATGCCAGGGTTGGTTTTTATTTTTATTTTTGCTATTTACCTAAAAAGAAAAAGAGACAATGCTTCAGTCAACTGCTTTTTTATTTA

AAATTTAAAGAAAAAAAAAAGAAAAAAAAAGCTGTAACCTTATCATTTCTGAGTAGACCATTAAGAGAAATGCACACCTGTCAGCCCAGGACCAGCTTTG

GTGGCTAAAGGGAATATTTTAACTCGCAAGGTGATGTTCTGTACAAAACGTGGTATATGTTACCCACAGTCCATTTCAGTTATTCCCACAAGTCAGGTCC

AGATAAATGAGGGTTATCAGCTAACTGATATGTTATCATTGAGGTTCGTCAATGAATTTGTACATTTCTAGTTCCCTTTGGTGAAGGGAAAAATGATTTT

GCAAGACCTAGATTTTGGCTTGGTTTCTTGCCTCCTTTTTTGGCAGCCTTCATCTTTTCCTAAAGCCCTTGAGCCTGTAGGGTTTTCATAGTGGACAAAG

GACTTAAATGGTCTTTTAAAACTGGGATAGTTTTTGGGGAAAGGGCAAAAGATTATCATATTGAACATGTAGTATCCCAATACTCTCAACAGTGGATAAT

TATGAGTAAACCCGGTCCTTTCGATGTTTAGAGTAAGCAGAGGCCCACAGTGGAGGCTTACCAAAGGTTGCAATGAGGAAGAGGCCTCTCCCTCACTGTC

AGCACCAGCTGGTAAAGGTGACTGTGCAGATGTGCATTTTCCTTTTGGTAGAAATGGTCCACAGCACTAACTGGTAAGGCTTATTGTACAGTATATTGTC

AGTATTCTTCTGGTTCAGCATACCTTATAGTTCGTATATAACCTGTATTAATTGTATAGATTGTGCATTTAAAGCTGTTACCAAGTTGTCAGAACCCTAA

GAATGAAAACAGGTCATATGTAATATTTTGTTTGTAAGTATCCTTTGTATCATAGCAAAGGAAATGTTTAAAAGATCAACTGTAATAAAAGTAATTTTAG

TACACAG
Translation
MPSTNRAGSLKDPEIAELFFKEDPEKLFTDLREIGHGSFGAVYF - UNI4684 - - UNI14534 - ARDVRTNEVVAIKKMSYSGKQSTE - UNI

14534 - KWQDIIKEVKFLQRIKHPNSIEYKGCYLREHTAW - UNI23588 - LVMEYCLGSASDLLEV VHKKPLQEVEIAAITHGALQGLAYLHS

HTMIHR - UNI27162 - RDIKAGNILLTEPGQVKLADFGSASMASPANSFVGTPYW WMAPEVILAMDEGQYDGKVDVWSLGITCIELA AERKPPL

FNMNAMSALYHIAQNESPTLQSNEW WSDYFRNFVDSCLQKIPQDRPTSEELLK - UNI4162 - HMFVLRERPETVLIDLIQRTKDAVRELDNLQYR

KMKKLLFQEAHNGPAVEAQEEEE EQDHGVGRTGTVNSVGSNQSIPSMSISASSQSSSVNSLPDASDDKSELDMMEGDHTVMSNSSVIHLKP EEENYQE

EGDPRTRASDPQSPPQVSRHKSHYRNREHFATIRTASL VTRQMQEHEQDSELREQMSGYKRMRRQHQKQLMTLENKLKAEMDEHRLRLDKDLETQRNNF

AAEMEKLIKKHQAAMEKE AKVMANEEKKFQQHIQAQQKKELNSFLESQKREYKLRKEQLKE ELNENQSTPKKEKQEWLSKQKENIQHFQAEEEANLLR

RQRQYLELECRRFKRRMLLGRHNLEQDLVRE ELNKRQTQKDLEHAMLLRQHESMQELEFRHLNTIQKMRCELIRLQHQTELTNQLEYNKRRERELRRKH

VMEVRQQPKSLK SKELQIKKQFQDTCKIQTRQYKALRNHLLETTPKSEHKAVLKRLKEEQTRKLAILAEQYDHSINEMLSTQA LRLDEAQEAECQVLK

MQLQQELELLNAYQSKIKMQAEAQHDRELRELEQRVSLRRALLEQK IEEEMLALQNERTERIRSLLERQAREIEAFDSESMRLGFSNMVLSNLSPEAFS

HSYPGASSWSHNPTGGPGPHWGHPMGGTPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSHMSYT


For any suggestions or comments, please send an email to unitrap@crg.es