Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000017299 (Dnttip1)
Chromosomal location
Chr 2: 164571521 - 164593717 (+)
Description
deoxynucleotidyltransferase, terminal, interacting protein 1 Gene [Source:MGI (curated);Acc:Dnttip1-001]
RefSeq_dna
NM_133763 
RefSeq_peptide
NP_598524.1 
UniGene
Mm.440009 
MGI
MGI:1923483 
Uniprot/SWISSPROT
Q99LB0 
Uniprot/SPTREMBL
Q3THA4 A2A4Y8 A2A4Y7 
Human Ortholog
ENSG00000101457 (DNTTIP1)
Omim not available
UniTrap UNI35027
Vector Insertion
Chr 2: 164571659 - 164572206
Public Clones IST10904C1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8633
Vector Insertion
Chr 2: 164573060 - 164576731
Public Clones RRK343 (baygenomics) RRK105 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32198
Vector Insertion
Chr 2: 164576795 - 164579609
Public Clones IST12457C10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1503
Vector Insertion
Chr 2: 164583560 - 164584751
Public Clones CC0761 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34002
Vector Insertion
Chr 2: 164584798 - 164587027
Public Clones IST12308B1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17009
Vector Insertion
Chr 2: 164587061 - 164588568
Public Clones IST14508C6 (tigm)
Private Clones OST450991 (lexicon)
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36736
Vector Insertion
Chr 2: 164588628 - 164588720
Public Clones IST13232G6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4179
Vector Insertion
Chr 2: 164588782 - 164590660
Public Clones AM0610 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17793
Vector Insertion
Chr 2: 164590733 - 164593206
Public Clones not available
Private Clones OST436356 (lexicon)
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35695
Vector Insertion
Chr 2: 164593263 - 164593362
Public Clones IST13702E6 (tigm) IST14214D5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000017443
Sequence
TCGAGCTGAGGTTGTTGTGGGCCGGGGGGCGCCATGGGGGCGACTGGCGACACCGAGCAGCCGCGGGGCCCCGGCGGGGCGGAGCGAGGTGGCCTGGAGC

TGGGCGACGCGGGCGCGGCGGGCCAGCCGGTTCTCACG AACCCTTGGAACATAATGATAAAACATCGGCAGGTGCAGCGAAGGGGCCGCCGATCTCAGA

TGACCACAAG TTTCACAGACCCAGCCATCTCTATGGATCTCCTCCGTGCTGTCCTGCAGCCTAGCATCAATGAGGAGATCCAGGGTGTCTTCAACAAGT

ACATGAAG - UNI8633 - - UNI32198 - TTCTTCCAGAAGGCAGCGCTGAATGTGCGAGACAATGTTGGGGAAGAAGTGGACGCAGAGCAGTTG

ATTCAGGAGGCCTGCCGCAGCTGCCTGGAGCAG GCAAAGCTGCTCTTTTCTGATGGAGAGAAAGTGATACCCAGATTGGCCCATGAGCTTCCAGGGATC

AAG CGGGGCCGGCAAGCAGAAGAGGAGTCCCACCGAGGAAGCCCCATTCCCAAAAAG AGGAAAGGTCGGCCTCCTGGACACGTCCTGTCAAATGACCG

CGCAGCTGCTGGCATGGT - UNI1503 - ATGGAAACAAAAATCCTGTGAACCAATTCGCCGAGAAGGCCCCAAG - UNI17009 - - UNI3400

2 - TGGGACCCAGCTCGGCTGAATGAATCTACCACCTTTGTTTTGGGGTCTCGAGCCAACAA GGCCTTGGGGATGGGAGGCACCAGAGGGAGAATCTA

CATCAAGCACCCACACCTCTTTAAG - UNI4179 - TATGCAGCAGATCCTCAGGACAAGCACTGGCTGGCTGAGCAGCATCACATGCGGGCAACAGG

CGGAAAGATG - UNI17793 - GCGTACCTTCTCATTGAAGAAGACATCCGGGACTTGGCTGCCAGCGATGACTACAG AGGATGCTTGGACCTGAAG

TTGGAGGAGCTGAAATCCTTTGTTCTGCCATCCTGGATGGTTGAGAAGATGCGGAAATACATGGAGACACTGCGGACAGAAAATGAGCACCGCGCTGCGG

AAGCGCCTCCCCAGACCTGAGCCGGGTGTCCTGGCTACTACACTTGGCGGCCTGCCTCCAAGACCCTCTTTCCCCACCCGGCTGAGGCCATCATGGGGAT

TTGGTCTAGTTGACTCTTAACAGCATTAAGCTGTACATGAGCTAGTTTGTAGTGACTCACTGCAGAGCACCCCAGACTGGCATGTGGTTCTGTTTCTAAA

GTTATTGGAATAAGAAGCAATTAAACAGTTTGTAAT
Translation
MGATGDTEQPRGPGGAERGGLELGDAGAAGQPVLT NPWNIMIKHRQVQRRGRRSQMTTS SFTDPAISMDLLRAVLQPSINEEIQGVFNKYMK - UNI

8633 - - UNI32198 - FFQKAALNVRDNVGEEVDAEQLIQEACRSCLEQ AKLLFSDGEKVIPRLAHELPGIK RGRQAEEESHRGSPIPKK RKG

RPPGHVLSNDRAAAGMV - UNI1503 - VWKQKSCEPIRREGPK - UNI17009 - - UNI34002 - WDPARLNESTTFVLGSRANK KALGMG

GTRGRIYIKHPHLFK - UNI4179 - YAADPQDKHWLAEQHHMRATGGKM - UNI17793 - AYLLIEEDIRDLAASDDYR RGCLDLKLEELKSF

VLPSWMVEKMRKYMETLRTENEHRAAEAPPQT
Transcript ENSMUST00000109327
Sequence
TCGAGCTGAGGTTGTTGTGGGCCGGGGGGCGCCATGGGGGCGACTGGCGACACCGAGCAGCCGCGGGGCCCCGGCGGGGCGGAGCGAGGTGGCCTGGAGC

TGGGCGACGCGGGCGCGGCGGGCCAGCCGGTTCTCACG AACCCTTGGAACATAATGATAAAACATCGGCAGGTGCAGCGAAGGGGCCGCCGATCTCAGA

TGACCACAAG TTTCACAGACCCAGCCATCTCTATGGATCTCCTCCGTGCTGTCCTGCAGCCTAGCATCAATGAGGAGATCCAGGGTGTCTTCAACAAGT

ACATGAAG - UNI8633 - - UNI32198 - TTCTTCCAGAAGGCAGCGCTGAATGTGCGAGACAATGTTGGGGAAGAAGTGGACGCAGAGCAGTTG

ATTCAGGAGGCCTGCCGCAGCTGCCTGGAGCAG GCAAAGCTGCTCTTTTCTGATGGAGAGAAAGTGATACCCAGATTGGCCCATGAGCTTCCAGGGATC

AAG CGGGGCCGGCAAGCAGAAGAGGAGTCCCACCGAGGAAGCCCCATTCCCAAAAAG AGGAAAGGTCGGCCTCCTGGACACGTCCTGTCAAATGACCG

CGCAGCTGCTGGCATGGT - UNI1503 - ATGGAAACAAAAATCCTGTGAACCAATTCGCCGAGAAGGCCCCAAG - UNI34002 - GACTTCAGG

ACCAGGTCTTCCGAAGGCTTCCCA
Translation
MGATGDTEQPRGPGGAERGGLELGDAGAAGQPVLT NPWNIMIKHRQVQRRGRRSQMTTS SFTDPAISMDLLRAVLQPSINEEIQGVFNKYMK - UNI

8633 - - UNI32198 - FFQKAALNVRDNVGEEVDAEQLIQEACRSCLEQ AKLLFSDGEKVIPRLAHELPGIK RGRQAEEESHRGSPIPKK RKG

RPPGHVLSNDRAAAGMV - UNI1503 - VWKQKSCEPIRREGPK - UNI34002 - DFRTRSSEGFP
Transcript ENSMUST00000109326
Sequence
TCGAGCTGAGGTTGTTGTGGGCCGGGGGGCGCCATGGGGGCGACTGGCGACACCGAGCAGCCGCGGGGCCCCGGCGGGGCGGAGCGAGGTGGCCTGGAGC

TGGGCGACGCGGGCGCGGCGGGCCAGCCGGTTCTCACG AACCCTTGGAACATAATGATAAAACATCGGCAGGTGCAGCGAAGGGGCCGCCGATCTCAGA

TGACCACAAG TTTCACAGACCCAGCCATCTCTATGGATCTCCTCCGTGCTGTCCTGCAGCCTAGCATCAATGAGGAGATCCAGGGTGTCTTCAACAAGT

ACATGAAG - UNI8633 - ATATTCCAGGACCAGAAGATGGCTAAGCGAGTGAAGGCCCTTCCCACCAAGAGTGACAGCTGA
Translation
MGATGDTEQPRGPGGAERGGLELGDAGAAGQPVLT NPWNIMIKHRQVQRRGRRSQMTTS SFTDPAISMDLLRAVLQPSINEEIQGVFNKYMK - UNI

8633 - IFQDQKMAKRVKALPTKSDS

For any suggestions or comments, please send an email to unitrap@crg.es