Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000017307 (Acot8)
Chromosomal location
Chr 2: 164618268 - 164630382 (-)
Description
acyl-CoA thioesterase 8 Gene [Source:MGI (curated);Acc:Acot8-002]
RefSeq_dna
NM_133240 
RefSeq_peptide
NP_573503.1 
MGI
MGI:2158201 
Uniprot/SWISSPROT
P58137 
Uniprot/SPTREMBL
Q3U965 Q8BZR4 
Human Ortholog
ENSG00000101473 (ACOT8)
Omim not available
UniTrap UNI23162
Vector Insertion
Chr 2: 164625446 - 164628496
Public Clones not available
Private Clones OST274302 (lexicon) OST54573 (lexicon) OST38039 (lexicon)
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26194
Vector Insertion
Chr 2: 164621310 - 164625219
Public Clones not available
Private Clones OST131428 (lexicon)
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000103094
Sequence
TCCGGAAGCGCTGGGAGCCTATATAAGTTTCCGCGTTTCTCTCAACCGCAGCCAGCAGTGAAAATGTCAGCGCCAGAGGGTCTGGGAGATGCTCATGGCG

ACGCCGACCGCGGCGACCTTTCCGGGGACCTCCGTAGTGTGCTGGTCACGAGCGTGCTCAACCTCGAGCCGCTAGATGAAGATCTCTACAG AGGAAGGC

ATTACTGGGTACCTACCTCCCAGCGGCTCTTTGGGGGTCAAATTATGGGCCAGGCCCTGGTGGCTGCAGCCAAGTCTGTGAGTGAAGACGTCCATGTCCA

CTCCCTGCACTGCTACTTTGTCCGGGCAG - UNI23162 - GGGACCCGAAAGTGCCAGTGCTGTACCACGTAGAGAGGATACGGACAGGAGCCAGCT

TCTCAGTGCGCGCCGTGAAGGCTGTGCAGCATGGCAAGGCCATCTTCATCTGCCAGGCCTCCTTCCAGCAGATGCAGCCCAGCCCGCTGCAGCACCAGTT

CTCCATGCCCTCCGTGCCCCCGCCAGAAGACCTGCTGGATCACGAGGCCCTCATTGACCAGTACTTAAG - UNI26194 - GGACCCTAACCTTCACA

AGAAGTATCGAGTGGGGCTGAACCGAGTTGCTGCCCAGGAGGTACCTATTGAGATCAAGGTGGTGAACCCACCCACCCTGACCCAGCTGCAGGCACTGGA

GCCCAAACAGATGTTCTGGGTGCGTGCCCGGGGCTACATTG GGGAAGGTGACATCAAGATGCATTGCTGTGTGGCTGCTTATATCTCTGACTACGCCTT

CCTGGGTACAGCACTGCTGCCCCACCAGTCCAAGTATAAGGTGAACTTCATGGCGTCACTGGATCACTCCATGTGGTTTCATGCCCCATTCCGAGCCGAC

CACTGGATGCTGTACGAGTGTGAGAGCCCCTGGGCTG GTGGCTCTCGAGGGCTGGTGCATGGGCGGCTGTGGCGTCGGGATGGGGTCCTTGCTGTGACC

TGTGCCCAGGAGGGTGTGATCCGATTGAAGCCTCAGGTGTCAGAGAGTAAGCTATAGTGAAAGATGCCTGGCTCGGCCTGGGGCTAAAAGGACTTTGCAC

TGCCATTTCTGAGGCAGGAGTCACAGTTGAGAGCTGGGCTTCCTGCCTCTTACATACAATAAAGAGATTGCTAACACTGG
Translation
MSAPEGLGDAHGDADRGDLSGDLRSVLVTSVLNLEPLDEDLYR RGRHYWVPTSQRLFGGQIMGQALVAAAKSVSEDVHVHSLHCYFVRAG - UNI231

62 - GDPKVPVLYHVERIRTGASFSVRAVKAVQHGKAIFICQASFQQMQPSPLQHQFSMPSVPPPEDLLDHEALIDQYLR - UNI26194 - RDPNL

HKKYRVGLNRVAAQEVPIEIKVVNPPTLTQLQALEPKQMFWVRARGYIG GEGDIKMHCCVAAYISDYAFLGTALLPHQSKYKVNFMASLDHSMWFHAPF

RADHWMLYECESPWAG GGSRGLVHGRLWRRDGVLAVTCAQEGVIRLKPQVSESKL
Transcript ENSMUST00000017451
Sequence
CTTCCGGAAGCGCTGGGAGCCTATATAAGTTTCCGCGTTTCTCTCAACCGCAGCCAGCAGTGAAAATGTCAGCGCCAGAGGGTCTGGGAGATGCTCATGG

CGACGCCGACCGCGGCGACCTTTCCGGGGACCTCCGTAGTGTGCTGGTCACGAGCGTGCTCAACCTCGAGCCGCTAGATGAAGATCTCTACAG AGGAAG

GCATTACTGGGTACCTACCTCCCAGCGGCTCTTTGGGGGTCAAATTATGGGCCAGGCCCTGGTGGCTGCAGCCAAGTCTGTGAGTGAAGACGTCCATGTC

CACTCCCTGCACTGCTACTTTGTCCGGGCAG - UNI23162 - GGGACCCGAAAGTGCCAGTGCTGTACCACGTAGAGAGGATACGGACAGGAGCCAG

CTTCTCAGTGCGCGCCGTGAAGGCTGTGCAGCATGGCAAGGCCATCTTCATCTGCCAGGCCTCCTTCCAGCAGATGCAGCCCAGCCCGCTGCAGCACCAG

TTCTCCATGCCCTCCGTGCCCCCGCCAGAAGACCTGCTGGATCACGAGGCCCTCATTGACCAGTACTTAAG - UNI26194 - GGACCCTAACCTTCA

CAAGAAGTATCGAGTGGGGCTGAACCGAGTTGCTGCCCAGGAGGTACCTATTGAGATCAAGGTGGTGAACCCACCCACCCTGACCCAGCTGCAGGCACTG

GAGCCCAAACAGATGTTCTGGGTGCGTGCCCGGGGCTACATTG GGGAAGGTGACATCAAGATGCATTGCTGTGTGGCTGCTTATATCTCTGACTACGCC

TTCCTGGGTACAGCACTGCTGCCCCACCAGTCCAAGTATAAG GTGGCTCTCGAGGGCTGGTGCATGGGCGGCTGTGGCGTCGGGATGGGGTCCTTGCTG

TGACCTGTGCCCAGGAGGGTGTGATCCGATTGAAGCCTCAGGTGTCAGAGAGTAAGCTATAGTGAAAGATGCCTGGCTCGGCCTGGGGCTAAAAGGACTT

TGCACTGCCATTTCTGAGGCAGGAGTCACAGTTGAGAGCTGGGCTTCCTGCCTCTTACATACAATAAAGAGATTGCTAACACTGGA
Translation
MSAPEGLGDAHGDADRGDLSGDLRSVLVTSVLNLEPLDEDLYR RGRHYWVPTSQRLFGGQIMGQALVAAAKSVSEDVHVHSLHCYFVRAG - UNI231

62 - GDPKVPVLYHVERIRTGASFSVRAVKAVQHGKAIFICQASFQQMQPSPLQHQFSMPSVPPPEDLLDHEALIDQYLR - UNI26194 - RDPNL

HKKYRVGLNRVAAQEVPIEIKVVNPPTLTQLQALEPKQMFWVRARGYIG GEGDIKMHCCVAAYISDYAFLGTALLPHQSKYK VALEGWCMGGCGVGMG

SLL

For any suggestions or comments, please send an email to unitrap@crg.es