Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000017421 (Zfp207)
Chromosomal location
Chr 11: 80196832 - 80209637 (+)
Description
zinc finger protein 207 Gene [Source:MGI (curated);Acc:Zfp207-002]
RefSeq_peptide
NP_001123641.1 NP_001123642.1 NP_001123643.1 NP_035881.1 
UniGene
Mm.402288 Mm.445214 
MGI
MGI:1340045 
Uniprot/SPTREMBL
B1AQG7 Q9JMD0 Q99LA2 Q9Z326 Q8CCB2 
Human Ortholog
ENSG00000010244 (ZNF207)
Omim not available
UniTrap UNI12564
Vector Insertion
Chr 11: 80196832 - 80196998
Public Clones M041F03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14668
Vector Insertion
Chr 11: 80196998 - 80199404
Public Clones FHCRC-GT-S2-1E1 (fhcrc) IST12937H1 (tigm) IST10559G1 (tigm) IST13572E5 (tigm)
IST10472C8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18900
Vector Insertion
Chr 11: 80199532 - 80201303
Public Clones not available
Private Clones OST411844 (lexicon) OST317827 (lexicon) OST275976 (lexicon) OST211024 (lexicon)
OST197927 (lexicon) OST60627 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15374
Vector Insertion
Chr 11: 80201443 - 80202479
Public Clones PST8319-NL (escells)
Private Clones OST436228 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25952
Vector Insertion
Chr 11: 80202648 - 80202756
Public Clones not available
Private Clones OST149393 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15247
Vector Insertion
Chr 11: 80204904 - 80205336
Public Clones PST10298-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21307
Vector Insertion
Chr 11: 80207786 - 80207787
Public Clones not available
Private Clones OST335021 (lexicon)
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000053740
Sequence
TGTTTCCTGCGGGACGCGCTGGTGGCGGTTGGTGTGGAGAACTCTGCGAGTCTCTTGGGTTTTTTGTTTTTTGTTTTTTCCAGCTTCTTTCCGCCTCTAT

TCTGCCTGTTCTGTAGGGCGCAGTTATGGGTCGCAAGAAGAAGAAGCAGCTCAAGCCGTGGTGCTG - UNI12564 - - UNI14668 - GTATTGT

AACAGAGATTTTGATGATGAGAAGATCCTTATACAGCACCAAAAAGCAAAGCATTTTAAATGCCATATTTGTCATAAGAAATTATACACAGGACCTGGTT

TAGCAATTCATTGCATGCAG - UNI18900 - GTCCATAAAGAAACCATAGATGCAGTACCAAATGCAATACCTGGGAGAACAGACATAGAGTTGGAA

ATATATGGCATGGAAGGTATTCCAGAGAAAGATATGGATGAAAGACGGCGACTTCTTGAACAGAAAACACAAG - UNI15374 - AGAGTCAGAAAAA

GAAACAACAAGATGATTCTGATGAATATGATGATGATGAATCTGCAGCCTCAACTTCCTTTCAGCCACAGCCTGTTCAACCTCAGCAAGGTTATATCCCA

CCAATGGCTCAGCCAGGACTGCCTCCAGTTCCAGGGGCACCAGGAATGCCTCCAG - UNI25952 - GCATACCTCCATTGATGCCAGGTGTTCCTCC

CCTGATGCCAGGCATGCCTCCAGTGATGCCAGGAATGCCGCCTGG ATTGCATCATCAGAGAAAATACACCCAGTCATTTTGCGGTGAAAACAT AATGA

TGCCAATGGGTGGAATGATGCCACCTGGACCTGGAATACCACCTCTGATGCCAGGTATGCCACCAG - UNI15247 - GTATGCCCCCACCTGTTCCA

CGTCCTGGAATTCCTCCAATGACTCAAGCACAGGCTGTTTCAGCACCAGGTATTCTTAATAGACCACCTGCACCAACAGCAGCAGTACCTGCTCCACAGC

CTCCAGTTACTAAGCCTCTTTTCCCCAGTGCTGGACAG ATGGGGACACCTGTAACAAGCTCAAGTACAGCTTCATCCAATTCAGAAAGTCTGTCTGCAT

CTTCTAAAGCTCTGTTTCCTAGCACAGCACAA - UNI21307 - GCTCAGGCAGCTGTCCAAGGACCTGTTGGTACAGATTTTAAGCCCTTAAATAGT

ACTCCTGCAGCAACAACTACAGAACCCCCAAAGCCTACATTCCCTGCTTATACACAGTCTACAGCGTCAACCACTAGTACAACAAACAGTACTGCAGCAA

AGCCAGCAGCTTCAATAACAAGTAAGCCTGCTACACTCACAACCACCAGTGCAACCAGTAAGTTGATCCATCCAGATGAGGATATATCACTG GAAGAAA

GAAGGGCACAGTTACCTAAATATCAGAGAAATCTTCCTCGACCAGGACAAACTCCAATTGGTAATCCACCAGTTGGACCAATTGGGGGTATGATGCCACC

ACAGCCAGGCCTGCCACAGCAGCAGGCAATGCGACCTCCAATGCCACCTCATG GTCAGTATGGTGGTCATCATCAAGGCATGCCAGGTTATCTTCCTGG

CGCTATGCCACCGTATGGACAGGGACCACCAATGGTGCCCCCTTACCAAGGTGGGCCTCCTCGACCTCCAATGGGAATGAGACCTCCTGTAATGTCGCAA

GGTGGCCGTTACTGATCTTACTTCATCAAGTCTAATAGGTTTGGAGATTAAACCTTTTCTCAACTTGTGCTGTTTATATAGACAAGCTTCCGTCATTAAG

GCTTCATTGTGACTTTTAACAAACATAATCTTCCCACATACCAGGAACTATTGGACATTTATTTGACATGGGAGAAATTATTTGGAATAATAAAACAGGA

ACTTTTCCTGAAGTTGCAATTTATACTGTATGGCTTCTTTTTCATGTTTCATCTAGGTTTTTAGAAGTGAAGTATAGTAAATTTGGTTCGTTAAATTGTG

AAGGCGCTGGAATTACATGAACATACCACCTTAAATAAAGGCAAGTTCTGTAAGATTACATTGCTATTTGTAAAGTTATGCCTTCGCAGCATTTCCAATG

CTGTTGGACTTCATGTCCCCAACCTAGCTTGGTGAGGGTTGTAACTGTTTCCAAGTACTTGTACATTGGAAGTTTGAATGTGTAACAATATTTAATGTAA

TTAGAGAGAGTTCCTCCTGTTGCAGGGTTTAAGAAAACGGGCCCATTATTATGGTCATGTGACTTTTCTGTACTGTTAAACTTCATTGTAATAAAATGAG

Translation
MGRKKKKQLKPWCW - UNI12564 - - UNI14668 - WYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQ - UNI18900 - VH

KETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQE - UNI15374 - ESQKKKQQDDSDEYDDDESAASTSFQPQPVQPQQGYIPPMA

QPGLPPVPGAPGMPPG - UNI25952 - GIPPLMPGVPPLMPGMPPVMPGMPPG GLHHQRKYTQSFCGENI IMMPMGGMMPPGPGIPPLMPGMPPG

 - UNI15247 - GMPPPVPRPGIPPMTQAQAVSAPGILNRPPAPTAAVPAPQPPVTKPLFPSAGQ MGTPVTSSSTASSNSESLSASSKALFPSTAQ 

- UNI21307 - AQAAVQGPVGTDFKPLNSTPAATTTEPPKPTFPAYTQSTASTTSTTNSTAAKPAASITSKPATLTTTSATSKLIHPDEDISL EERR

AQLPKYQRNLPRPGQTPIGNPPVGPIGGMMPPQPGLPQQQAMRPPMPPHG GQYGGHHQGMPGYLPGAMPPYGQGPPMVPPYQGGPPRPPMGMRPPVMSQ

GGRY
Transcript ENSMUST00000017567
Sequence
TGTTTCCTGCGGGACGCGCTGGTGGCGGTTGGTGTGGAGAACTCTGCGAGTCTCTTGGGTTTTTTGTTTTTTGTTTTTTCCAGCTTCTTTCCGCCTCTAT

TCTGCCTGTTCTGTAGGGCGCAGTTATGGGTCGCAAGAAGAAGAAGCAGCTCAAGCCGTGGTGCTG - UNI12564 - - UNI14668 - GTATTGT

AACAGAGATTTTGATGATGAGAAGATCCTTATACAGCACCAAAAAGCAAAGCATTTTAAATGCCATATTTGTCATAAGAAATTATACACAGGACCTGGTT

TAGCAATTCATTGCATGCAG - UNI18900 - GTCCATAAAGAAACCATAGATGCAGTACCAAATGCAATACCTGGGAGAACAGACATAGAGTTGGAA

ATATATGGCATGGAAGGTATTCCAGAGAAAGATATGGATGAAAGACGGCGACTTCTTGAACAGAAAACACAAG - UNI15374 - AGAGTCAGAAAAA

GAAACAACAAGATGATTCTGATGAATATGATGATGATGAATCTGCAGCCTCAACTTCCTTTCAGCCACAGCCTGTTCAACCTCAGCAAGGTTATATCCCA

CCAATGGCTCAGCCAGGACTGCCTCCAGTTCCAGGGGCACCAGGAATGCCTCCAG - UNI25952 - GCATACCTCCATTGATGCCAGGTGTTCCTCC

CCTGATGCCAGGCATGCCTCCAGTGATGCCAGGAATGCCGCCTGG ATTGCATCATCAGAGAAAATACACCCAGTCATTTTGCGGTGAAAACAT AATGA

TGCCAATGGGTGGAATGATGCCACCTGGACCTGGAATACCACCTCTGATGCCAGGTATGCCACCAG - UNI15247 - GTATGCCCCCACCTGTTCCA

CGTCCTGGAATTCCTCCAATGACTCAAGCACAGGCTGTTTCAGCACCAGGTATTCTTAATAGACCACCTGCACCAACAGCAGCAGTACCTGCTCCACAGC

CTCCAGTTACTAAGCCTCTTTTCCCCAGTGCTGGACAG - UNI21307 - GCTCAGGCAGCTGTCCAAGGACCTGTTGGTACAGATTTTAAGCCCTTA

AATAGTACTCCTGCAGCAACAACTACAGAACCCCCAAAGCCTACATTCCCTGCTTATACACAGTCTACAGCGTCAACCACTAGTACAACAAACAGTACTG

CAGCAAAGCCAGCAGCTTCAATAACAAGTAAGCCTGCTACACTCACAACCACCAGTGCAACCAGTAAGTTGATCCATCCAGATGAGGATATATCACTG G

AAGAAAGAAGGGCACAGTTACCTAAATATCAGAGAAATCTTCCTCGACCAGGACAAACTCCAATTGGTAATCCACCAGTTGGACCAATTGGGGGTATGAT

GCCACCACAGCCAGGCCTGCCACAGCAGCAGGCAATGCGACCTCCAATGCCACCTCATG GTCAGTATGGTGGTCATCATCAAGGCATGCCAGGTTATCT

TCCTGGCGCTATGCCACCGTATGGACAGGGACCACCAATGGTGCCCCCTTACCAAGGTGGGCCTCCTCGACCTCCAATGGGAATGAGACCTCCTGTAATG

TCGCAAGGTGGCCGTTACTGATCTTACTTCATCAAGTCTAATAGGTTTGGAGATTAAACCTTTTCTCAACTTGTGCTGTTTATATAGACAAGCTTCCGTC

ATTAAGGCTTCATTGTGACTTTTAACAAACATAATCTTCCCACATACCAGGAACTATTGGACATTTATTTGACATGGGAGAAATTATTTGGAATAATAAA

ACAGGAACTTTTCCTGAAGTTGCAATTTATACTGTATGGCTTCTTTTTCATGTTTCATCTAGGTTTTTAGAAGTGAAGTATAGTAAATTTGGTTCGTTAA

ATTGTGAAGGCGCTGGAATTACATGAACATACCACCTTAAATAAAGGCAAGTTCTGTAAGATTACATTGCTATTTGTAAAGTTATGCCTTCGCAGCATTT

CCAATGCTGTTGGACTTCATGTCCCCAACCTAGCTTGGTGAGGGTTGTAACTGTTTCCAAGTACTTGTACATTGGAAGTTTGAATGTGTAACAATATTTA

ATGTAATTAGAGAGAGTTCCTCCTGTTGCAGGGTTTAAGAAAACGGGCCCATTATTATGGTCATGTGACTTTTCTGTACTGTTAAACTTCATTGTAATAA

AATGAG
Translation
MGRKKKKQLKPWCW - UNI12564 - - UNI14668 - WYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQ - UNI18900 - VH

KETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQE - UNI15374 - ESQKKKQQDDSDEYDDDESAASTSFQPQPVQPQQGYIPPMA

QPGLPPVPGAPGMPPG - UNI25952 - GIPPLMPGVPPLMPGMPPVMPGMPPG GLHHQRKYTQSFCGENI IMMPMGGMMPPGPGIPPLMPGMPPG

 - UNI15247 - GMPPPVPRPGIPPMTQAQAVSAPGILNRPPAPTAAVPAPQPPVTKPLFPSAGQ - UNI21307 - AQAAVQGPVGTDFKPLNST

PAATTTEPPKPTFPAYTQSTASTTSTTNSTAAKPAASITSKPATLTTTSATSKLIHPDEDISL EERRAQLPKYQRNLPRPGQTPIGNPPVGPIGGMMPP

QPGLPQQQAMRPPMPPHG GQYGGHHQGMPGYLPGAMPPYGQGPPMVPPYQGGPPRPPMGMRPPVMSQGGRY
Transcript ENSMUST00000108216
Sequence
GTTTCCTGCGGGACGCGCTGGTGGCGGTTGGTGTGGAGAACTCTGCGAGTCTCTTGGGTTTTTTGTTTTTTGTTTTTTCCAGCTTCTTTCCGCCTCTATT

CTGCCTGTTCTGTAGGGCGCAGTTATGGGTCGCAAGAAGAAGAAGCAGCTCAAGCCGTGGTGCTG - UNI12564 - - UNI14668 - GTATTGTA

ACAGAGATTTTGATGATGAGAAGATCCTTATACAGCACCAAAAAGCAAAGCATTTTAAATGCCATATTTGTCATAAGAAATTATACACAGGACCTGGTTT

AGCAATTCATTGCATGCAG - UNI18900 - GTCCATAAAGAAACCATAGATGCAGTACCAAATGCAATACCTGGGAGAACAGACATAGAGTTGGAAA

TATATGGCATGGAAGGTATTCCAGAGAAAGATATGGATGAAAGACGGCGACTTCTTGAACAGAAAACACAAG - UNI15374 - AGAGTCAGAAAAAG

AAACAACAAGATGATTCTGATGAATATGATGATGATGAATCTGCAGCCTCAACTTCCTTTCAGCCACAGCCTGTTCAACCTCAGCAAGGTTATATCCCAC

CAATGGCTCAGCCAGGACTGCCTCCAGTTCCAGGGGCACCAGGAATGCCTCCAG - UNI25952 - GCATACCTCCATTGATGCCAGGTGTTCCTCCC

CTGATGCCAGGCATGCCTCCAGTGATGCCAGGAATGCCGCCTGG ATTGCATCATCAGAGAAAATACACCCAGTCATTTTGCGGTGAAAACAT AATGAT

GCCAATGGGTGGAATGATGCCACCTGGACCTGGAATACCACCTCTGATGCCAGGTATGCCACCAG - UNI15247 - GTATGCCCCCACCTGTTCCAC

GTCCTGGAATTCCTCCAATGACTCAAGCACAGGCTGTTTCAGCACCAGGTATTCTTAATAGACCACCTGCACCAACAGCAGCAGTACCTGCTCCACAGCC

TCCAGTTACTAAGCCTCTTTTCCCCAGTGCTGGACAG ATGGGGACACCTGTAACAAGCTCAAGTACAGCTTCATCCAATTCAGAAAGTCTGTCTGCATC

TTCTAAAGCTCTGTTTCCTAGCACAGCACAAGTACGCAGGAAGTTGCAGTTTAAAATTGTTAAAATGGCTTTACAACTTAACCCTTTGGACCCTTTATGA

AAGCTAATCTTACCAATATATTTAGGTTTTTTTTTTTAGAAGTAAAACAAATACTACAACTCATCCTGTTTGCAAATTTGAATTCATATTAATGATTCCA

ACAAAGTAACTCTAAACTTCTGTGGCTCTAAAGGGTTAAAAGCATGTGAGCAGTAATGAACTATAGTGGCCAATGGTTAGCCTTGATGCATGGTTAAGCT

ACTTTTGATTAATGCTGTTTAATGCGTCACATCTTTATGTAAGAAAGTTAGCACTCTGCATTTGTTTCTAAGGTTGATCTAGTTAACATTTTAAACACTT

GTATCATGAAAGTAATATGTGCTACTGTTAACTTTATTTAGAACCTGTGCCATTAACCCTTTTGTCTATACTGTGTTCTAGTCCTTACTAATTGGAGGGT

AGTGTGCTGCTCTCTGTAGAACACTTGCGTAGTTGGTGACAATGATGAGTCACTATTACCGGGAGGTTTTTAATGCTTACAAAGGGGTTTATTATCCCAG

CCTATAGCTTCAATTTTTTGAGCTGCTTAAAAGATGAATTATTAGCCAGGTGTGGTGGCGCACGCCTTTGATCCCAGCACTTGGGAGGCAGAGGCAGCTG

GATTTCTGAGTTTGAGGCCAGCCTGGTCTACAAAGTTCCAGGACAGCCAGGGCTACAGAGAAACCCTGTCTCCAAAACCCCCCCCCCCCCCCAAAAAAAA

AAGATGAATTACTTTAAACAAAGAATTTAGGAGACTAAAAGCAGTTGCATTAAATACTATTTTGTAATTCTATAGCAAATGAAAAAAAGAATACAAGGCA

TTGTAAATTAAGGGTTTTTTTTGGAGAGTTAGGCATCTGAGAAGTATAGTAATTACAGCCCAGTATTTTTGGATATTGAATTGATTTGGATTAAATTTTG

CAAAACATTTATCAGACATTTTACTTGGTTTTGGTTTTGTTTGAAGTTTGACCTATTTAATGTTGGTGTCATATATTTATTTTTGTTATACTCAACTTTG

GATATTGACATTTTACTAATAAAGGATCGTTACTTTAT
Translation
MGRKKKKQLKPWCW - UNI12564 - - UNI14668 - WYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQ - UNI18900 - VH

KETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQE - UNI15374 - ESQKKKQQDDSDEYDDDESAASTSFQPQPVQPQQGYIPPMA

QPGLPPVPGAPGMPPG - UNI25952 - GIPPLMPGVPPLMPGMPPVMPGMPPG GLHHQRKYTQSFCGENI IMMPMGGMMPPGPGIPPLMPGMPPG

 - UNI15247 - GMPPPVPRPGIPPMTQAQAVSAPGILNRPPAPTAAVPAPQPPVTKPLFPSAGQ MGTPVTSSSTASSNSESLSASSKALFPSTAQV

RRKLQFKIVKMALQLNPLDPL

For any suggestions or comments, please send an email to unitrap@crg.es