Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000017446 (C1qtnf1)
Chromosomal location
Chr 11: 118289813 - 118311277 (+)
Description
C1q and tumor necrosis factor related protein 1 Gene [Source:MGI (curated);Acc:C1qtnf1-002]
Human Ortholog
not available
Omim not available
UniTrap UNI37838
Vector Insertion
Chr 11: 118289883 - 118295166
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000017590
Sequence
AAGAGACGCCTCCCCGAGAGCCCTGAGAGGCTGGAGGATTTCATTGCACAGCCGGCTCAGCTGGAAGGAG - UNI37838 - GAAGATGGGCTCCTGT

GCACAGGGATTCATGCTGGGATGCTGCCTGCTGCTGGCCATCACCTGGGGCCCCATCCTGAGCCTTGTGCCACGAGTTCAGGAGGAACAACAGGAGTGGG

AAGAGACAGAGGAGCTGCCATCTCCTCTGGATCCTGTGACAAG GCCTGAAGAAACACGAGAGAAGTATAGCCCTCGCCAGGGTGAGGACCTCCCCACTT

CTCGGTGCTACCGATGCTGTGACCCCAGCACACCTGTATACCAGACAATTCCTCCACCCCAGATCAACATCACCATCCTGAAAG GCGAGAAAGGTGACC

GAGGGGATCGAGGCCTCCAGGGGAAGTACGGCAAAATAGGTTCTACAGGTCCCAGGGGCCATGTTGGCCCCAAAGGGCAGAAGGGATCCATTGGAGCCCC

TGGGAACCACTGCAAGAGCCAGTACGCAGCCTTCTCCGTGGGCCGGAAGAAGGCTTTGCACAGCAACGACTACTTCCAGCCCGTGGTCTTCGACACGGAG

TTTGTGAACCTCTACAAACACTTCAATATGTTCACTGGGAAGTTCTACTGCTATGTGCCGGGCATCTACTTCTTCAGCCTCAACGTGCACACTTGGAACC

AGAAGGAGACGTACCTGCACATCATGAAGAACGAGGAGGAGGTGGTGATCCTGTATGCGCAGGTGAGCGACCGCAGCATCATGCAGAGTCAGAGCCTGAT

GATGGAGCTGCGGGAGGAGGATGAGGTCTGGGTGCGTCTCTTCAAGGGCGAGCGTGAGAACGCCATTTTCAGTGACGAGTTCGACACCTACATCACCTTC

AGTGGCTACCTGGTCAAGCCAGCCTCTGAGCCCTAGTGGACACTCCTGTGGAGCTTTTGTGGACTGCTGACCTCCTTGCCTGGCACCCTGACCTATCCCT

GCATTCTACAGACACTGGAGTCCTGCCCCGGGCTGACCCCATTTTCTCTCTGCTCCATCCTGGCTTCCTTGGCCTTGGCTTCCAAAGTTTTGGCTTTTGA

CAAGATGCCCTTGGCCACTGGGAATCCCAAAGGACGGTGCGATCCCAGATCTGGCTGCTACTCTAAGCAGAGAGCTGCCGGCAGATGAAATCATTGGGCG

GGGAGCCTGTGAGGATATTGGGGGGCCTCCAGCTCCTTCTGTGTACACAGCCTTAGACGACCCTGTGCTGTGTTGTCCCGTGGCCACAGGGTGTTCCAGA

GCACAGCCCCTGTGTGTTCCCATTCCTGGACACAAGTAAGCAAATATCATGGGTTTCTTAGGAACGAAGTCAAGCAGAAAAGAGAAAGAAAGGTGGTGTT

AGTTTTGGCTTTCCAGCCAGCTGGAGGGAGGGATGGGGAGAGAGAGAGAGCGAGAGCTATTTGTATTGGGGAAACTGAGGCATAGGAAAAACATGAATGG

CAACAGAGTAGCTGCAGTTTGTGGGTTTGGAAACCACATCTGACTTAACTCTAGATCACATATGAGCTTTCCTGGGGACAGCAGGACTGACCTCCGAGCT

CTGTTGACATGCTATAGCCTTGCCCAGGGGCTGGTCAATCTTTCTGAGCCACACTAGTAAAAGGGTTGGGGGAGAACAGCAAGTGCCCCCTGTGGTTGGC

TCTGGGCTGGTGGCAGCATCCTGCTTGCCCCAACTCACAGGATCCTGACAGCAGCTGGGAACCTCAGGGACTCCTGCAGCTTTCTCTGTAAGAAATAAAG

CTCCTACTATGTCCCAGTACCTCTCTGCTCTGCTCCACTTCCCCAGTCACTCTGGACCCCAGGGTGGGAGGGCTCTCTTGCCTGTTGGGACATCAGTTCC

CCTTCCTCCTTCTTGGTGAATTAACCATGGAAGGACCAGGGCTCGGATTTGGGTTCCCAAACTGCCCTTCACCATCCCTAGTGCCCTGCTTCCTTCCCAG

TTCAGCATCCTGTCTGGGAACTTGATACTTTAACCTGCTAGAGCGGATGAGTCTGATAGACCTGCCCAGCCCTGACACAGCCCTAGTCAGCTTATGGACA

CGTGAGAGGGACTTCCTTTGAGACCCAGAGCTGGGGTAGAGCTATAAAAATCTACCTATTCCCGGGTCAACCCCAAGTGGTAGAAGAGGACACAGGCTAT

CCCGCCCCTAGCTCAGACTCAGGGAAGGCCTCAGGCCTGATTCTCTGATTGCAGAGAGCCTGTGTTCTTTCCCCATCTCACCCCGTGTTGATCCCCAGGG

CCTGGGCCACTGGATATCTGCTTTGTGCCAACTAGGCCTTGCTTGCTGCTTCCTGGTGGCCCTTGGTTAGGATCCCTCTCTTTTCCTTCTGGAGCTCAAT

GTACGTATATGCCACCTCCGAAGGGGCTTCTGCTGGTCAGACTCTCCAAGCCACTTCCATGGGTGTGCCTACAGCAGAGGCTGCTGCCTCCTGTGCTCTA

CCCTGCTCTTTCCAGAAAACATTAAACTTGCCATGGCGATTCACAGC
Translation
 - UNI37838 - MGSCAQGFMLGCCLLLAITWGPILSLVPRVQEEQQEWEETEELPSPLDPVTR RPEETREKYSPRQGEDLPTSRCYRCCDPSTPVY

QTIPPPQINITILKG GEKGDRGDRGLQGKYGKIGSTGPRGHVGPKGQKGSIGAPGNHCKSQYAAFSVGRKKALHSNDYFQPVVFDTEFVNLYKHFNMFT

GKFYCYVPGIYFFSLNVHTWNQKETYLHIMKNEEEVVILYAQVSDRSIMQSQSLMMELREEDEVWVRLFKGERENAIFSDEFDTYITFSGYLVKPASEP
Transcript ENSMUST00000106286
Sequence
AAGAGATGGGATTGTTATAGGCGGAAAGAGAGAAACCCAGAGAAGTCCAG GAAGATGGGCTCCTGTGCACAGGGATTCATGCTGGGATGCTGCCTGCTG

CTGGCCATCACCTGGGGCCCCATCCTGAGCCTTGTGCCACGAGTTCAGGAGGAACAACAGGAGTGGGAAGAGACAGAGGAGCTGCCATCTCCTCTGGATC

CTGTGACAAG GCCTGAAGAAACACGAGAGAAGTATAGCCCTCGCCAGGGTGAGGACCTCCCCACTTCTCGGTGCTACCGATGCTGTGACCCCAGCACAC

CTGTATACCAGACAATTCCTCCACCCCAGATCAACATCACCATCCTGAAAG GCGAGAAAGGTGACCGAGGGGATCGAGGCCTCCAGGGGAAGTACGGCA

AAATAGGTTCTACAGGTCCCAGGGGCCATGTTGGCCCCAAAGGGCAGAAGGGATCCATTGGAGCCCCTGGGAACCACTGCAAGAGCCAGTACGCAGCCTT

CTCCGTGGGCCGGAAGAAGGCTTTGCACAGCAACGACTACTTCCAGCCCGTGGTCTTCGACACGGAGTTTGTGAACCTCTACAAACACTTCAATATGTTC

ACTGGGAAGTTCTACTGCTATGTGCCGGGCATCTACTTCTTCAGCCTCAACGTGCACACTTGGAACCAGAAGGAGACGTACCTGCACATCATGAAGAACG

AGGAGGAGGTGGTGATCCTGTATGCGCAGGTGAGCGACCGCAGCATCATGCAGAGTCAGAGCCTGATGATGGAGCTGCGGGAGGAGGATGAGGTCTGGGT

GCGTCTCTTCAAGGGCGAGCGTGAGAACGCCATTTTCAGTGACGAGTTCGACACCTACATCACCTTCAGTGGCTACCTGGTCAAGCCAGCCTCTGAGCCC

TAGTGGACACTCCTGTGGAGCTTTTGTGGACTGCTGACCTCCTTGCCTGGCACCCTGACCTATCCCTGCATTCTACAGACACTGGAGTCCTGCCCCGGGC

TGACCCCATTTTCTCTCTGCTCCATCCTGGCTTCCTTGGCCTTGGCTTCCAAAGTTTTGGCTTTTGACAAGATGCCCTTGGCCACTGGGAATCCCAAAGG

ACGGTGCGATCCCAGATCTGGCTGCTACTCTAAGCAGAGAGCTGCCGGCAGATGAAATCATTGGGCGGGGAGCCTGTGAGGATATTGGGGGGCCTCCAGC

TCCTTCTGTGTACACAGCCTTAGACGACCCTGTGCTGTGTTGTCCCGTGGCCACAGGGTGTTCCAGAGCACAGCCCCTGTGTGTTCCCATTCCTGGACAC

AAGTAAGCAAATATCATGGGTTTCTTAGGAACGAAGTCAAGCAGAAAAGAGAAAGAAAGGTGGTGTTAGTTTTGGCTTTCCAGCCAGCTGGAGGGAGGGA

TGGGGAGAGAGAGAGAGCGAGAGCTATTTGTATTGGGGAAACTGAGGCATAGGAAAAACATGAATGGCAACAGAGTAGCTGCAGTTTGTGGGTTTGGAAA

CCACATCTGACTTAACTCTAGATCACATATGAGCTTTCCTGGGGACAGCAGGACTGACCTCCGAGCTCTGTTGACATGCTATAGCCTTGCCCAGGGGCTG

GTCAATCTTTCTGAGCCACACTAGTAAAAGGGTTGGGGGAGAACAGCAAGTGCCCCCTGTGGTTGGCTCTGGGCTGGTGGCAGCATCCTGCTTGCCCCAA

CTCACAGGATCCTGACAGCAGCTGGGAACCTCAGGGACTCCTGCAGCTTTCTCTGTAAGAAATAAAGCTCCTACTATGTCCCAGTACCTCTCTGCTCTGC

TCCACTTCCCCAGTCACTCTGGACCCCAGGGTGGGAGGGCTCTCTTGCCTGTTGGGACATCAGTTCCCCTTCCTCCTTCTTGGTGAATTAACCATGGAAG

GACCAGGGCTCGGATTTGGGTTCCCAAACTGCCCTTCACCATCCCTAGTGCCCTGCTTCCTTCCCAGTTCAGCATCCTGTCTGGGAACTTGATACTTTAA

CCTGCTAGAGCGGATGAGTCTGATAGACCTGCCCAGCCCTGACACAGCCCTAGTCAGCTTATGGACACGTGAGAGGGACTTCCTTTGAGACCCAGAGCTG

GGGTAGAGCTATAAAAATCTACCTATTCCCGGGTCAACCCCAAGTGGTAGAAGAGGACACAGGCTATCCCGCCCCTAGCTCAGACTCAGGGAAGGCCTCA

GGCCTGATTCTCTGATTGCAGAGAGCCTGTGTTCTTTCCCCATCTCACCCCGTGTTGATCCCCAGGGCCTGGGCCACTGGATATCTGCTTTGTGCCAACT

AGGCCTTGCTTGCTGCTTCCTGGTGGCCCTTGGTTAGGATCCCTCTCTTTTCCTTCTGGAGCTCAATGTACGTATATGCCACCTCCGAAGGGGCTTCTGC

TGGTCAGACTCTCCAAGCCACTTCCATGGGTGTGCCTACAGCAGAGGCTGCTGCCTCCTGTGCTCTACCCTGCTCTTTCCAGAAAACATTAAACTTGCCA

TGGCGATTCACAGCA
Translation
 MGSCAQGFMLGCCLLLAITWGPILSLVPRVQEEQQEWEETEELPSPLDPVTR RPEETREKYSPRQGEDLPTSRCYRCCDPSTPVYQTIPPPQINITIL

KG GEKGDRGDRGLQGKYGKIGSTGPRGHVGPKGQKGSIGAPGNHCKSQYAAFSVGRKKALHSNDYFQPVVFDTEFVNLYKHFNMFTGKFYCYVPGIYFF

SLNVHTWNQKETYLHIMKNEEEVVILYAQVSDRSIMQSQSLMMELREEDEVWVRLFKGERENAIFSDEFDTYITFSGYLVKPASEP
Transcript ENSMUST00000106284
Sequence
AGTGATTCAACAGCTCTGGTCGAG GAAGATGGGCTCCTGTGCACAGGGATTCATGCTGGGATGCTGCCTGCTGCTGGCCATCACCTGGGGCCCCATCCT

GAGCCTTGTGCCACGAGTTCAGGAGGAACAACAGGAGTGGGAAGAGACAGAGGAGCTGCCATCTCCTCTGGATCCTGTGACAAG GCCTGAAGAAACACG

AGAGAAGTATAGCCCTCGCCAGGGTGAGGACCTCCCCACTTCTCGGTGCTACCGATGCTGTGACCCCAGCACACCTGTATACCAGACAATTCCTCCACCC

CAGATCAACATCACCATCCTGAAAG GCGAGAAAGGTGACCGAGGGGATCGAGGCCTCCAGGGGAAGTACGGCAAAATAGGTTCTACAGGTCCCAGGGGC

CATGTTGGCCCCAAAGGGCAGAAGGGATCCATTGGAGCCCCTGGGAACCACTGCAAGAGCCAGTACGCAGCCTTCTCCGTGGGCCGGAAGAAGGCTTTGC

ACAGCAACGACTACTTCCAGCCCGTGGTCTTCGACACGGAGTTTGTGAACCTCTACAAACACTTCAATATGTTCACTGGGAAGTTCTACTGCTATGTGCC

GGGCATCTACTTCTTCAGCCTCAACGTGCACACTTGGAACCAGAAGGAGACGTACCTGCACATCATGAAGAACGAGGAGGAGGTGGTGATCCTGTATGCG

CAGGTGAGCGACCGCAGCATCATGCAGAGTCAGAGCCTGATGATGGAGCTGCGGGAGGAGGATGAGGTCTGGGTGCGTCTCTTCAAGGGCGAGCGTGAGA

ACGCCATTTTCAGTGACGAGTTCGACACCTACATCACCTTCAGTGGCTACCTGGTCAAGCCAGCCTCTGAGCCCTAGTGGACACTCCTGTGGAGCTTTTG

TGGACTGCTGACCTCCTTGCCTGGCACCCTGACCTATCCCTGCATTCTACAGACACTGGAGTCCTGCCCCGGGCTGACCCCATTTTCTCTCTGCTCCATC

CTGGCTTCCTTGGCCTTGGCTTCCAAAGTTTTGGCTTTTGACAAGATGCCCTTGGCCACTGGGAATCCCAAAGGACGGTGCGATCCCAGATCTGGCTGCT

ACTCTAAGCAGAGAGCTGCCGGCAGATGAAATCATTGGGCGGGGAGCCTGTGAGGATATTGGGGGGCCTCCAGCTCCTTCTGTGTACACAGCCTTAGACG

ACCCTGTGCTGTGTTGTCCCGTGGCCACAGGGTGTTCCAGAGCACAGCCCCTGTGTGTTCCCATTCCTGGACACAAGTAAGCAAATATCATGGGTTTCTT

AGGAACGAAGTCAAGC
Translation
 MGSCAQGFMLGCCLLLAITWGPILSLVPRVQEEQQEWEETEELPSPLDPVT  

For any suggestions or comments, please send an email to unitrap@crg.es