Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000017550 (Atad5)
Chromosomal location
Chr 11: 79902902 - 79949296 (+)
Description
ATPase family, AAA domain containing 5 Gene [Source:MGI (curated);Acc:Atad5-001]
RefSeq_dna
NM_001029856 
RefSeq_peptide
NP_001025027.1 
UniGene
Mm.89551 Mm.474897 
MGI
MGI:2442925 
Uniprot/SWISSPROT
Q4QY64 
Human Ortholog
ENSG00000176208 (ATAD5)
Omim not available
UniTrap UNI22312
Vector Insertion
Chr 11: 79903339 - 79907656
Public Clones not available
Private Clones OST300823 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22808
Vector Insertion
Chr 11: 79909525 - 79911454
Public Clones E080C09 (ggtc)
Private Clones OST284293 (lexicon)
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21836
Vector Insertion
Chr 11: 79913978 - 79915283
Public Clones E067G07 (ggtc)
Private Clones OST315914 (lexicon)
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1160
Vector Insertion
Chr 11: 79916844 - 79919755
Public Clones BB0143 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12426
Vector Insertion
Chr 11: 79927809 - 79932466
Public Clones A028E08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12087
Vector Insertion
Chr 11: 79934278 - 79937568
Public Clones A060E03 (ggtc) IST12776A12BBF1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8251
Vector Insertion
Chr 11: 79937634 - 79940758
Public Clones RRF055 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17895
Vector Insertion
Chr 11: 79940940 - 79944705
Public Clones IST10789G3 (tigm)
Private Clones OST434125 (lexicon)
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13502
Vector Insertion
Chr 11: 79944885 - 79945966
Public Clones CMHD-GT_302D10-3 (cmhd) IST12086C2 (tigm) IST11508F8 (tigm) IST12491H3 (tigm)
Private Clones OST443393 (lexicon)
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30023
Vector Insertion
Chr 11: 79946809 - 79947530
Public Clones (sanger) D152C04 (ggtc) IST11012G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13336
Vector Insertion
Chr 11: 79947690 - 79947794
Public Clones CMHD-GT_396G8-3 (cmhd) CMHD-GT_423C4-3 (cmhd) CMHD-GT_459D4-3 (cmhd) CMHD-GT_380H2-3 (cmhd)
CMHD-GT_320F11-3 (cmhd) IST10558H10 (tigm) IST13516E4 (tigm) IST12749C9 (tigm)
IST10289D4 (tigm) IST14445G3 (tigm) IST11114F1 (tigm) IST13517H11 (tigm)
IST12978D10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000017694
Sequence
GCTCCGGACGGCGGGAAAACCCAATTGACAGAACTCCCGCCGAAGCCCCACTAGTCCGATCTGCGTTCTGTGGGGCTCGAGCGCTTATTCTGGAGAATCT

GCCCCGGGGGCACCTTGTATTGTCCCGCCGCCACCTCGGGGCCTGAGCCCGGGCTTCCCGTACATCTCTGTCTGAGTCTGACTCGGCGGCCCTGGGCCCA

GCCTCTCACTCGCGTCCGGCCGGTGGTCTCTACGAGACCCGAGACGGGCTCCCCGGCTCGCAGCTCGCTCCCACTGGACCTGCCGCCCCTATGGCCTCCA

GCCAGGCTGGGCCGGACCTCTGAAGGGCCTAGGAGCCCGGGTTCTAGGAGGCAGAGATCATGGTGGGGGTCCTGAGCATGGCGGCGGCTGCAGCACCCCT

TCCTGTGAAGGACTACGAGATTGAG - UNI22312 - CCATGCAAAAAGCGGAGAAAAGATGATGACAACTCTTCCTGCGAAACAATCACCAAATATT

TATCACCAATAGGGAAGACTGGAGACAAGGTTTTCTCTCCACCAAAACCCAGTAATATTCTACATTATTTTAGAAAGACCTCACTCACAACCGAGAAGCC

ACAATCGACAAAGGCGTACAAAATAAAGCCATCTCCCCCATTGCTTGTTGGCAACAGCAAAGACTGTAAGACGCCATTGGAAGTATTCTCAAATAGAGAA

TTTAAGAGGAAAAGAAAGAGAGTTAGTTTATCCTCTCAACTGAATGATATTAAAATTCAGGATGAGTGTCCAGTTGAAATTAGTAACAATGATAGTAAGG

AGGACGGTGGTTTAAGTGATTGTGTGGAAAGCAGTGCTTCTGTTTCCCTTTACAAGGAACATGTGGAGGTTCTCGCAGAAAGTATTGAAGACAGCAGAAA

CCAGCCAAATACTAAGTCCTCCAAAAAGAAAGTAAATCCTAAACAATGCACCACAAAAAGTGATGACAGGATACTGAGGAAGAGGAAGCGTAGCAAGGTA

ACGGGTCAGTCTGAAAGTGTGCCCTTAGCAGATGAACTTAGTCTGCCTGAGGATGGTGGCAAAGACAGCAAGCTGACTAAACCTTCCCTAGCTGAGGAAA

ACGACTCCAGGACTCATGCAACCAAAAGAGCTGATTTAAAGGAGAGTACAATTACTGTCTCCTATGAGGAATTTGTAAAAAGTCACAAGGCAGCTAAAGT

GGAAGAGATACCTGACCCTGCAGTTCCAGCCTGTGTTCCTTCTGGGCCAGGTGAAGCAGTCAAAAGTGGTTCTGAAGGCGAATTGTCGGGAAGCTGCGAA

CCATCGCCACAGCTGCACCTCAAGACAGTTACTGTTCTTGCACAAGTTCACCCCACTCCCCCTAAGAAGAAAGGGAAAATACCCCCAATTTTCTTGAAAC

AGAAGCAGCCTGAGCTGGAGAATAGTCTCTCTGACCCAGAAAATGAGCAGCCAGTTCAGAAGAGGAAATCTAATGTTGTGATCCAGGAGGGCCAATTAGA

GCTGGCGGTGCTGGAAGCCTGGAACTCTGAGGCTTCAGTACCAAAGTGCAGCATGGAGGAAAGACAGCAGTTCATGAGAGCATTTAGGCAGCCACCGCCA

GACACGCTCAAAAATGGATTCAAGAAACCTCTGGAGAAGCAGAAAGACCCAAGTGAAAAATCTGTCCATGAAGGAGATAGCAGTTCTGAAAAAATTATAG

AAAATCCTAATATTCAAAGAGTTTCAAGCCAAGGCTGTCTACAGTCACATGCCGATAGAGGAAGTTTTCCTAAGGAGAAAAGTAAAAAGCCAAATAAAAA

GGGTAAGAAAACTAGGACTACTGCAGGTGGAAACAGAGAAGAAAACATACAAAAGGAAAAAACAGCCTTTTCCTTAAAAGATGAACAGGATCAAAATAGC

CTACGAAGGAGTGTAAGACAGAAATCAGAAGTTCTCAAAAGCAATGCATTACTTAACAGTGAAAATCTTGTTTGTGAGGATACGGCACATGACTCTGTAC

AAATGTCTCTGTGTAATAGAAATAAGTCAAGAAGCAGCAGCACACCAACCAGGGATATGGTTACACATCACAGAGCTGAGCCTGGAAGTAGCCTGGAGTA

TGTCTCTACACGCCAACCAATCAGGAGATCTCTGAGAAGTTGCAGCACGCCTGCAACAAATGCTCTGGGAGGTACTGAGTCTGAGGATGCTCAGGACACT

ATTCCAGTGAAGGCTTCCACCCCAAAATCAGCCAGAACATCAGAAAAGCACAACCTGTATACAGCAGAATTAATAATAGTATCTTCTGATTCCGAGAGCC

CCATTAG - UNI22808 - AATGAAATTCACTAGAATTAGTACTCCCAAAAAATCCAAGAAAAGTTCTAAGAAATCTGAAACAACTGAGGAAGAGCTC

ACTTCTCAGAAGAAAAAG GCAAATAGTACTTCAAAAAATATATCAAAAGCAAAAGAACTGATTGAGGAAGCAAAAGCATTCCAAATTGGCGGATCAAAG

ACTGAAGAAACAGTGGTACCCTTGAGGCGGTCCTCTAGGCACCAGGCACGTTCTGCAAAGGAGAAGTCGCCAGAGATAGAT - UNI21836 - GACTC

TGTAATAGTAATAGACTCAAGTCCAACTTCTATAAGAGAACCAGAGAAAAGTCAGAAGAAACTTCAGAATCTGAATGATGTACTAGGAAAAAAACTTAAC

AAGTCTTCTAAAAATGTCCCTG GAAAAATGAAAATTGCTCCTTTATTTCTTGCCAAAAGGACCAAAAGAGCAGCCATTCCTGTCTTTGATTTGGATGAA

AGCAG - UNI1160 - TCAAGATTCATCAGAACAAACTCAGGATTGTGATGTACAGTTTAAAGCAAAGCGTGATTTTCTAATGAGTGGTTTGCCAGAT

TTACTGAAACGTCAGATTGCAAAGAAAGCTGCTGCATTAGATGTGTACAATGCAGTGAGTACAAGTTTCCAGAGGGTTGTTCATGTACAACAGAAGGATG

ATG AATATTGGTTATGGCATTTGAAGCCACCTTCTTGTCCTCTGTTAACTGAATTTAAGGAATTAAATACTAAAGTAACAGATCTCTCAGAATATGTTG

TTGCTTTTGGTGAATTTTCCACCTTGAATCCAAATCCAAGAAGTAATCCTGCTGCTGTG ATGATGAGGACAAGGAAGGACTTTACTAAAGAAGTAAGAA

ACCTTTTGCTGGAGGAAATAAAGTGCTCAAATCCAGAATTTTCTTTGGAAAAATATTTTCCCTTGCTTCTTAAAAAACGAATTGAACACCAGGTACTTTG

TGAGGGTCATGGTAAACAAG CAAGTCCACAACTACAGCCTGATGTCAGTCAAAAAGAAACCAAAAGGAAACAAGTGGCAACGGGAAATCAGAAGTCAAA

AAGAAAGAGACAAAATGAATATTCAGTGAGCCCGGAAGAGATGAAGGGGAGATCAAAAGACCTTGACGAAAGAATCAGCTCTTCTTGTACAAATCTAGAT

CCTTCCAGAG ATTCTGGAACTGAAGACATGCTTTGGACAGAAAAGTACCAACCTCAGAATTCGAATGAACTCATAGGCAATGAGTTAGCTGTCAAAAAG

TTACATAG TTGGTTGAAGGACTGGAAAAGAAGAGCTGAACTGGAAGAAAGACATAATTTGAAAGGAAAGAGAGATGAAAAAGAGGAAGGTATTTTGG A

TTTATCGGATAGCACGGACTTTAAAGGCAGTTCAGATGATGAAGAGAATCGTCTTTGCAACACTGTTCTTATAACAGGACCAACGGGAGTGGGAAAAACT

GCTGCCGTGTATGCTTGTGCTCAGGAGCTTGGGTTTAAG ATATTTGAAGTGAATGCCTCTTCACAGCGAAGTGGTAGGCAAATCCTGTCTCAGCTGAAG

GAAGCTACCCAGTCCCATCAAGTAGATAAGCAAGGTGTAAACTCACAAAAACCCTGTTTCTTTAACAACTACAACATTGGCAAGTCACCAA - UNI124

26 - AAAAGTTAAACTCCCCGGGGAAAGTTGTTACATCACCAAGGAAGCTTCCTCCATCGTCACCAAAGACAAGTGGGCAGAAGCGAGCACTTCTTCCT

AAAACTTTGGCAAATTACTTTAAAGTGTCCTCCAAATCCAAAAGTAATGACGACGTAGGAGCACTCATGGGAGATGACAAAG GAGTCAAAAATTCGTCT

TTGGAACAGAGGCAACTTATTCAGACTAAATCAACCAATGCAAATAATTCACATATTAAAGATGTTGGAGCTGAAGAATCCAACAGGAAGAAGGCGACAT

CACTCATTCTCTTTGAGGAG GTTGATGTCATTTTTGATGAAGATGCTGGGTTTTTGAATGCAGTCAAAACCTTCATGGCAACAACTAAACGACCAGTAA

TTCTCACGACAAGTG - UNI12087 - ATCCCACATTTAGTCTAGTGTTTGATGGCTGCTTTGAAGAAATCAATTTCAGTATTCCTTCCCTG - UNI

8251 - CTAAATGTTGCCAGCTATCTACAAGTGATTTGTCTAGTTGAGAATTTCAGAACTGACTTTAAAGACTTTGTAACCTTGTTGACTGCAAATGCT

TGTGACATCAGAAAAAGTATCCTTTACTTACAGTTTTGGATTAGAAGTGGAGGTGGAATTTTAGAAGAAAGGCCATTATCACACTGTC - UNI17895 

- GAGAAAATAGCAGAAATACACTGGTTTGTTCAGAAGATGGCTCTGATGCAAACATCAACTCTAAAAAACCCAAAAGGAACCGTGTGGCCCTCCCCAGG

TGTGACACTGGCTGTGCAGAGGCTTTGTTTGGACTCAAGAACATTGCCTCCCCATCCCAGGACTTACTTTCATTATTGAAG - UNI13502 - CACAA

GATCACAACAAAGGAAGAATGGCAGAAACTCATTCAGGTTCTCACCGAATTCCACGTGCAAAATATCGATCTGCTACATAGTAACCTTGAGGTCATCCTG

CCACTGCCAGTTCATGTGGTTCCAGATGTAAGGGGTGCTTATGGCTTCCCAGTGACTACACAGGCCAGTGCACCAGCAAGCATGGGGCATCTTACCAGGA

AGCAGTCAAAAGACCAGCCATTGAGAAAGTCACAGAAAAGGAAACAGAAAAAGATGGTGATCCTAGATGACAGTGACCTGTTTGACACTGGCCTAGACTT

TTCTGGTGAACTGCCTAGCCTATCTCCTGCACCCTCCTTGTCTGTAGAAGACAACATAAGAAGAGACAGCAATCCAGAGATTAAGACACAGAACAGTGGT

TTCAAGCCCCACTCTGTACCTCAGCCCCCTAAGACACTAGCAGAGAAGAAGTGTTGCATGCTCGTTTCCCACTGTTTAAATTCTCTCAGTGAGTTCATGG

AGAACATGTCCTTCATAGATGCTCTTTTAACAGATCCAGGGGAACAGAATGAATTGGGTAGAAGTGCCTTTCACTGGACAAATGGAAGGGTTAAAAGTGG

ACTTTGTGATGAGTTTAGTCTTGAGAATAGAGACAGGTGGGCTCCTCAGAGCGCTGGAGAATTAAAAGCAACTGCAGAAGCACTGAGCTTTACTGAGTGT

TCTTCTACCATTTCAAAAGCACTGGAGTCCTTGAATTCATGCAAGCAATTAGAAAGAGACCCAACCAATGAACTCACAGTCTGTGTTTCACAAAGGCGCC

ATGATGCATGCTTCCGCCAATCAGCAGCTAATCTAGA - UNI30023 - CAATGCTGACAAGAGGATGGCAGTTATTAAAAGTGTGTTTTCTAGTCGT

TCTTTTCTGACCCTGGGTAATAAACAAGCTAGTATAATTGACTACCTGCCAACTCTTCGGAACATTTGTCGGACAGAAAAGCTAAAAGAACAAGAGAAAA

ATAAAAGAAG - UNI13336 - GTTTCTGCACTATTTTGAAGGAATTCATCTAGAGATTCCTGAAGAAACCATAACTACTTTGGCAGCTGACTTCCCT

TGATGCTCCCCGTCGTCAGCCTTGTAGAGACTGTGTGGTCCTGATGACTCTAGAGTATGGTGACTTTAAAGAAGAGCTTATTTCTCTTAATGTAAATTTT

GAAAGACTTTTGTATTTTTGTGGTTCAAGTTTAAAATGAAAAATTTGAGTTACAAATTGTATATATGACTGTGACATTTTTTCTGAATGTTTGGATTATC

TATTTTTGCTTTATTGTATACTTTCTGTATGTGTGAACTGTTTGTAGAATAATTTTCACTTATAGATTTCTAGAGCTGTTTCAGTTCTAAGCTTACCTGT

CATTTTTCCCTTTTCCTGTAATTGTCCTCTCCTGCCAAGCAGCAGAGCTGTGCCACTGTAAATAGGCAGTCTCTAAAGTTACACAATGGAAAACAGTTAT

GTACAGGGTATTTTAAAATGTCCTAGGAAGTAAATTATGCCTCGGTTGTGAAAAGCATTGCCTTTGTTTCTTGTGCCTTCTTCCACCACGTTTTACATGT

AATCATTGAGTCATTAGCACTGGCAGAGTAAAGCCTTCTGAATTCTAGCATTTGCCTAGATAAGACCATCTGTCACTCACTCCCTGTAGTTACACAGTCC

AGTGAATCTTGCCAACTCAAGTCGTTTGTACATTTTCTGGTACTTTTATATCATTGTTTTATTTCATAAAGTAATGACACTGTTTATCTGTTGTGGACAA

CTTGTTGATGGTTCAAGAAGTAATGACGGATTCTACCATGGGGCTTCTACCTGACTGCTGTTCCCATTTGAGTATGGCGTTTGTTGTTGGTTTTTGTTTT

TGGTGCTGAGGATTAAATTTAAGGGTTTTTGTATTATAGGCAAATGTCTTGTATCCTAGTATATACACAGGCGTTGTGTTTTACTAATTATTTGCAGTGG

TACGTATCAAATCCAAGATCTCGTGCATTCTATGAACATGCTAAACCACAGAGCGAGAACCCCCATCCTGTTTTTGAGGCAGGGTCTGGTATATTGCTTA

GGCTACTCCTAATCTCCTTCCAGAATTTTGTAATCCCCGTCTCAAGCTCCTTCAGTACTTACAGGTATTTGCTACCACACTGAGCAAGGTCATCTTTTAA

TATTTTTTGAGTACCTATTTTTAACTTTAGTAGCAAGTTTTTAAAATGCACATTTTACTTAATGTTATTTTGCAGATTATGAGGTTTGTTTAAAATTCCT

TCATAATGTAAATATTTGTATAATAATATATTATTCAGGTACATTTTCTGATGAATTGTATTTTTAATTCAGAAGGTAAGGATCCTAGTTTTGTACTTTT

TAAAAATATAGTTGCATACCTGTTTACAAATGTGTATAAAGATGTGTTTTTACCTCTTGTTCAACCTACCTTCTTGAATTAGTTAGTAAATTGATCTAAT

TAAAGCTAAATGCTTGGTGTGTT
Translation
MVGVLSMAAAAAPLPVKDYEIE - UNI22312 - PCKKRRKDDDNSSCETITKYLSPIGKTGDKVFSPPKPSNILHYFRKTSLTTEKPQSTKAYKIKP

SPPLLVGNSKDCKTPLEVFSNREFKRKRKRVSLSSQLNDIKIQDECPVEISNNDSKEDGGLSDCVESSASVSLYKEHVEVLAESIEDSRNQPNTKSSKKK

VNPKQCTTKSDDRILRKRKRSKVTGQSESVPLADELSLPEDGGKDSKLTKPSLAEENDSRTHATKRADLKESTITVSYEEFVKSHKAAKVEEIPDPAVPA

CVPSGPGEAVKSGSEGELSGSCEPSPQLHLKTVTVLAQVHPTPPKKKGKIPPIFLKQKQPELENSLSDPENEQPVQKRKSNVVIQEGQLELAVLEAWNSE

ASVPKCSMEERQQFMRAFRQPPPDTLKNGFKKPLEKQKDPSEKSVHEGDSSSEKIIENPNIQRVSSQGCLQSHADRGSFPKEKSKKPNKKGKKTRTTAGG

NREENIQKEKTAFSLKDEQDQNSLRRSVRQKSEVLKSNALLNSENLVCEDTAHDSVQMSLCNRNKSRSSSTPTRDMVTHHRAEPGSSLEYVSTRQPIRRS

LRSCSTPATNALGGTESEDAQDTIPVKASTPKSARTSEKHNLYTAELIIVSSDSESPIR - UNI22808 - RMKFTRISTPKKSKKSSKKSETTEEEL

TSQKKK ANSTSKNISKAKELIEEAKAFQIGGSKTEETVVPLRRSSRHQARSAKEKSPEID - UNI21836 - DSVIVIDSSPTSIREPEKSQKKLQN

LNDVLGKKLNKSSKNVPG GKMKIAPLFLAKRTKRAAIPVFDLDESS - UNI1160 - SQDSSEQTQDCDVQFKAKRDFLMSGLPDLLKRQIAKKAAA

LDVYNAVSTSFQRVVHVQQKDDE EYWLWHLKPPSCPLLTEFKELNTKVTDLSEYVVAFGEFSTLNPNPRSNPAAV MMRTRKDFTKEVRNLLLEEIKCS

NPEFSLEKYFPLLLKKRIEHQVLCEGHGKQA ASPQLQPDVSQKETKRKQVATGNQKSKRKRQNEYSVSPEEMKGRSKDLDERISSSCTNLDPSRD DSG

TEDMLWTEKYQPQNSNELIGNELAVKKLHS SWLKDWKRRAELEERHNLKGKRDEKEEGILD DLSDSTDFKGSSDDEENRLCNTVLITGPTGVGKTAAV

YACAQELGFK IFEVNASSQRSGRQILSQLKEATQSHQVDKQGVNSQKPCFFNNYNIGKSPK - UNI12426 - KKLNSPGKVVTSPRKLPPSSPKTS

GQKRALLPKTLANYFKVSSKSKSNDDVGALMGDDKG GVKNSSLEQRQLIQTKSTNANNSHIKDVGAEESNRKKATSLILFEE VDVIFDEDAGFLNAVK

TFMATTKRPVILTTSD - UNI12087 - DPTFSLVFDGCFEEINFSIPSL - UNI8251 - LNVASYLQVICLVENFRTDFKDFVTLLTANACDIR

KSILYLQFWIRSGGGILEERPLSHCR - UNI17895 - RENSRNTLVCSEDGSDANINSKKPKRNRVALPRCDTGCAEALFGLKNIASPSQDLLSLLK

 - UNI13502 - HKITTKEEWQKLIQVLTEFHVQNIDLLHSNLEVILPLPVHVVPDVRGAYGFPVTTQASAPASMGHLTRKQSKDQPLRKSQKRKQKK

MVILDDSDLFDTGLDFSGELPSLSPAPSLSVEDNIRRDSNPEIKTQNSGFKPHSVPQPPKTLAEKKCCMLVSHCLNSLSEFMENMSFIDALLTDPGEQNE

LGRSAFHWTNGRVKSGLCDEFSLENRDRWAPQSAGELKATAEALSFTECSSTISKALESLNSCKQLERDPTNELTVCVSQRRHDACFRQSAANLD - UN

I30023 - DNADKRMAVIKSVFSSRSFLTLGNKQASIIDYLPTLRNICRTEKLKEQEKNKRR - UNI13336 - RFLHYFEGIHLEIPEETITTLAA

DFP
Transcript ENSMUST00000108239
Sequence
TCCGCCCCCTGCGCTCCGGACGGCGGGAAAACCCAATTGACAGAACTCCCGCCGAAGCCCCACTAGTCCGATCTGCGTTCTGTGGGGCTCGAGCGCTTAT

TCTGGAGAATCTGCCCCGGGGGCACCTTGTATTGTCCCGCCGCCACCTCGGGGCCTGAGCCCGGGCTTCCCGTACATCTCTGTCTGAGTCTGACTCGGCG

GCCCTGGGCCCAGCCTCTCACTCGCGTCCGGCCGGTGGTCTCTACGAGACCCGAGACGGGCTCCCCGGCTCGCAGCTCGCTCCCACTGGACCTGCCGCCC

CTATGGCCTCCAGCCAGGCTGGGCCGGACCTCTGAAGGGCCTAGGAGCCCGGGTTCTAGGAGGCAGAGATCATGGTGGGGGTCCTGAGCATGGCGGCGGC

TGCAGCACCCCTTCCTGTGAAGGACTACGAGATTGAG - UNI22312 - CCATGCAAAAAGCGGAGAAAAGATGATGACAACTCTTCCTGCGAAACAA

TCACCAAATATTTATCACCAATAGGGAAGACTGGAGACAAGGTTTTCTCTCCACCAAAACCCAGTAATATTCTACATTATTTTAGAAAGACCTCACTCAC

AACCGAGAAGCCACAATCGACAAAGGCGTACAAAATAAAGCCATCTCCCCCATTGCTTGTTGGCAACAGCAAAGACTGTAAGACGCCATTGGAAGTATTC

TCAAATAGAGAATTTAAGAGGAAAAGAAAGAGAGTTAGTTTATCCTCTCAACTGAATGATATTAAAATTCAGGATGAGTGTCCAGTTGAAATTAGTAACA

ATGATAGTAAGGAGGACGGTGGTTTAAGTGATTGTGTGGAAAGCAGTGCTTCTGTTTCCCTTTACAAGGAACATGTGGAGGTTCTCGCAGAAAGTATTGA

AGACAGCAGAAACCAGCCAAATACTAAGTCCTCCAAAAAGAAAGTAAATCCTAAACAATGCACCACAAAAAGTGATGACAGGATACTGAGGAAGAGGAAG

CGTAGCAAGGTAACGGGTCAGTCTGAAAGTGTGCCCTTAGCAGATGAACTTAGTCTGCCTGAGGATGGTGGCAAAGACAGCAAGCTGACTAAACCTTCCC

TAGCTGAGGAAAACGACTCCAGGACTCATGCAACCAAAAGAGCTGATTTAAAGGAGAGTACAATTACTGTCTCCTATGAGGAATTTGTAAAAAGTCACAA

GGCAGCTAAAGTGGAAGAGATACCTGACCCTGCAGTTCCAGCCTGTGTTCCTTCTGGGCCAGGTGAAGCAGTCAAAAGTGGTTCTGAAGGCGAATTGTCG

GGAAGCTGCGAACCATCGCCACAGCTGCACCTCAAGACAGTTACTGTTCTTGCACAAGTTCACCCCACTCCCCCTAAGAAGAAAGGGAAAATACCCCCAA

TTTTCTTGAAACAGAAGCAGCCTGAGCTGGAGAATAGTCTCTCTGACCCAGAAAATGAGCAGCCAGTTCAGAAGAGGAAATCTAATGTTGTGATCCAGGA

GGGCCAATTAGAGCTGGCGGTGCTGGAAGCCTGGAACTCTGAGGCTTCAGTACCAAAGTGCAGCATGGAGGAAAGACAGCAGTTCATGAGAGCATTTAGG

CAGCCACCGCCAGACACGCTCAAAAATGGATTCAAGAAACCTCTGGAGAAGCAGAAAGACCCAAGTGAAAAATCTGTCCATGAAGGAGATAGCAGTTCTG

AAAAAATTATAGAAAATCCTAATATTCAAAGAGTTTCAAGCCAAGGCTGTCTACAGTCACATGCCGATAGAGGAAGTTTTCCTAAGGAGAAAAGTAAAAA

GCCAAATAAAAAGGGTAAGAAAACTAGGACTACTGCAGGTGGAAACAGAGAAGAAAACATACAAAAGGAAAAAACAGCCTTTTCCTTAAAAGATGAACAG

GATCAAAATAGCCTACGAAGGAGTGTAAGACAGAAATCAGAAGTTCTCAAAAGCAATGCATTACTTAACAGTGAAAATCTTGTTTGTGAGGATACGGCAC

ATGACTCTGTACAAATGTCTCTGTGTAATAGAAATAAGTCAAGAAGCAGCAGCACACCAACCAGGGATATGGTTACACATCACAGAGCTGAGCCTGGAAG

TAGCCTGGAGTATGTCTCTACACGCCAACCAATCAGGAGATCTCTGAGAAGTTGCAGCACGCCTGCAACAAATGCTCTGGGAGGTACTGAGTCTGAGGAT

GCTCAGGACACTATTCCAGTGAAGGCTTCCACCCCAAAATCAGCCAGAACATCAGAAAAGCACAACCTGTATACAGCAGAATTAATAATAGTATCTTCTG

ATTCCGAGAGCCCCATTAG - UNI22808 - AATGAAATTCACTAGAATTAGTACTCCCAAAAAATCCAAGAAAAGTTCTAAGAAATCTGAAACAACT

GAGGAAGAGCTCACTTCTCAGAAGAAAAAG GCAAATAGTACTTCAAAAAATATATCAAAAGCAAAAGAACTGATTGAGGAAGCAAAAGCATTCCAAATT

GGCGGATCAAAGACTGAAGAAACAGTGGTACCCTTGAGGCGGTCCTCTAGGCACCAGGCACGTTCTGCAAAGGAGAAGTCGCCAGAGATAGAT - UNI2

1836 - GACTCTGTAATAGTAATAGACTCAAGTCCAACTTCTATAAGAGAACCAGAGAAAAGTCAGAAGAAACTTCAGAATCTGAATGATGTACTAGGA

AAAAAACTTAACAAGTCTTCTAAAAATGTCCCTG GAAAAATGAAAATTGCTCCTTTATTTCTTGCCAAAAGGACCAAAAGAGCAGCCATTCCTGTCTTT

GATTTGGATGAAAGCAG - UNI1160 - TCAAGATTCATCAGAACAAACTCAGGATTGTGATGTACAGTTTAAAGCAAAGCGTGATTTTCTAATGAGT

GGTTTGCCAGATTTACTGAAACGTCAGATTGCAAAGAAAGCTGCTGCATTAGATGTGTACAATGCAGTGAGTACAAGTTTCCAGAGGGTTGTTCATGTAC

AACAGAAGGATGATG AATATTGGTTATGGCATTTGAAGCCACCTTCTTGTCCTCTGTTAACTGAATTTAAGGAATTAAATACTAAAGTAACAGATCTCT

CAGAATATGTTGTTGCTTTTGGTGAATTTTCCACCTTGAATCCAAATCCAAGAAGTAATCCTGCTGCTGTG ATGATGAGGACAAGGAAGGACTTTACTA

AAGAAGTAAGAAACCTTTTGCTGGAGGAAATAAAGTGCTCAAATCCAGAATTTTCTTTGGAAAAATATTTTCCCTTGCTTCTTAAAAAACGAATTGAACA

CCAGGTACTTTGTGAGGGTCATGGTAAACAAG CAAGTCCACAACTACAGCCTGATGTCAGTCAAAAAGAAACCAAAAGGAAACAAGTGGCAACGGGAAA

TCAGAAGTCAAAAAGAAAGAGACAAAATGAATATTCAGTGAGCCCGGAAGAGATGAAGGGGAGATCAAAAGACCTTGACGAAAGAATCAGCTCTTCTTGT

ACAAATCTAGATCCTTCCAGAG ATTCTGGAACTGAAGACATGCTTTGGACAGAAAAGTACCAACCTCAGAATTCGAATGAACTCATAGGCAATGAGTTA

GCTGTCAAAAAGTTACATAG TTGGTTGAAGGACTGGAAAAGAAGAGCTGAACTGGAAGAAAGACATAATTTGAAAGGAAAGAGAGATGAAAAAGAGGAA

G ATTTATCGGATAGCACGGACTTTAAAGGCAGTTCAGATGATGAAGAGAATCGTCTTTGCAACACTGTTCTTATAACAGGACCAACGGGAGTGGGAAAA

ACTGCTGCCGTGTATGCTTGTGCTCAGGAGCTTGGGTTTAAG ATATTTGAAGTGAATGCCTCTTCACAGCGAAGTGGTAGGCAAATCCTGTCTCAGCTG

AAGGAAGCTACCCAGTCCCATCAAGTAGATAAGCAAGGTGTAAACTCACAAAAACCCTGTTTCTTTAACAACTACAACATTGGCAAGTCACCAA - UNI

12426 - AAAAGTTAAACTCCCCGGGGAAAGTTGTTACATCACCAAGGAAGCTTCCTCCATCGTCACCAAAGACAAGTGGGCAGAAGCGAGCACTTCTT

CCTAAAACTTTGGCAAATTACTTTAAAGTGTCCTCCAAATCCAAAAGTAATGACGACGTAGGAGCACTCATGGGAGATGACAAAG GAGTCAAAAATTCG

TCTTTGGAACAGAGGCAACTTATTCAGACTAAATCAACCAATGCAAATAATTCACATATTAAAGATGTTGGAGCTGAAGAATCCAACAGGAAGAAGGCGA

CATCACTCATTCTCTTTGAGGAG GTTGATGTCATTTTTGATGAAGATGCTGGGTTTTTGAATGCAGTCAAAACCTTCATGGCAACAACTAAACGACCAG

TAATTCTCACGACAAGTG - UNI12087 - ATCCCACATTTAGTCTAGTGTTTGATGGCTGCTTTGAAGAAATCAATTTCAGTATTCCTTCCCTG - 

UNI8251 - CTAAATGTTGCCAGCTATCTACAAGTGATTTGTCTAGTTGAGAATTTCAGAACTGACTTTAAAGACTTTGTAACCTTGTTGACTGCAAAT

GCTTGTGACATCAGAAAAAGTATCCTTTACTTACAGTTTTGGATTAGAAGTGGAGGTGGAATTTTAGAAGAAAGGCCATTATCACACTGTC - UNI178

95 - GAGAAAATAGCAGAAATACACTGGTTTGTTCAGAAGATGGCTCTGATGCAAACATCAACTCTAAAAAACCCAAAAGGAACCGTGTGGCCCTCCCC

AGGTGTGACACTGGCTGTGCAGAGGCTTTGTTTGGACTCAAGAACATTGCCTCCCCATCCCAGGACTTACTTTCATTATTGAAG - UNI13502 - CA

CAAGATCACAACAAAGGAAGAATGGCAGAAACTCATTCAGGTTCTCACCGAATTCCACGTGCAAAATATCGATCTGCTACATAGTAACCTTGAGGTCATC

CTGCCACTGCCAGTTCATGTGGTTCCAGATGTAAGGGGTGCTTATGGCTTCCCAGTGACTACACAGGCCAGTGCACCAGCAAGCATGGGGCATCTTACCA

GGAAGCAGTCAAAAGACCAGCCATTGAGAAAGTCACAGAAAAGGAAACAGAAAAAGATGGTGATCCTAGATGACAGTGACCTGTTTGACACTGGCCTAGA

CTTTTCTGGTGAACTGCCTAGCCTATCTCCTGCACCCTCCTTGTCTGTAGAAGACAACATAAGAAGAGACAGCAATCCAGAGATTAAGACACAGAACAGT

GGTTTCAAGCCCCACTCTGTACCTCAGCCCCCTAAGACACTAGCAGAGAAGAAGTGTTGCATGCTCGTTTCCCACTGTTTAAATTCTCTCAGTGAGTTCA

TGGAGAACATGTCCTTCATAGATGCTCTTTTAACAGATCCAGGGGAACAGAATGAATTGGGTAGAAGTGCCTTTCACTGGACAAATGGAAGGGTTAAAAG

TGGACTTTGTGATGAGTTTAGTCTTGAGAATAGAGACAGGTGGGCTCCTCAGAGCGCTGGAGAATTAAAAGCAACTGCAGAAGCACTGAGCTTTACTGAG

TGTTCTTCTACCATTTCAAAAGCACTGGAGTCCTTGAATTCATGCAAGCAATTAGAAAGAGACCCAACCAATGAACTCACAGTCTGTGTTTCACAAAGGC

GCCATGATGCATGCTTCCGCCAATCAGCAGCTAATCTAGA - UNI30023 - CAATGCTGACAAGAGGATGGCAGTTATTAAAAGTGTGTTTTCTAGT

CGTTCTTTTCTGACCCTGGGTAATAAACAAGCTAGTATAATTGACTACCTGCCAACTCTTCGGAACATTTGTCGGACAGAAAAGCTAAAAGAACAAGAGA

AAAATAAAAGAAG - UNI13336 - GTTTCTGCACTATTTTGAAGGAATTCATCTAGAGATTCCTGAAGAAACCATAACTACTTTGGCAGCTGACTTC

CCTTGATGCTCCCCGTCGTCAGCCTTGTAGAGACTGTGTGGTCCTGATGACTCTAGAGTATGGTGACTTTAAAGAAGAGCTTATTTCTCTTAATGTAAAT

TTTGAAAGACTTTTGTATTTTTGTGGTTCAAGTTTAAAATGAAAAATTTGAGTTACAAATTGTATATATGACTGTGACATTTTTTCTGAATGTTTGGATT

ATCTATTTTTGCTTTATTGTATACTTTCTGTATGTGTGAACTGTTTGTAGAATAATTTTCACTTATAGATTTCTAGAGCTGTTTCAGTTCTAAGCTTACC

TGTCATTTTTCCCTTTTCCTGTAATTGTCCTCTCCTGCCAAGCAGCAGAGCTGTGCCACTGTAAATAGGCAGTCTCTAAAGTTACACAATGGAAAACAGT

TATGTACAGGGTATTTTAAAATGTCCTAGGAAGTAAATTATGCCTCGGTTGTGAAAAGCATTGCCTTTGTTTCTTGTGCCTTCTTCCACCACGTTTTACA

TGTAATCATTGAGTCATTAGCACTGGCAGAGTAAAGCCTTCTGAATTCTAGCATTTGCCTAGATAAGACCATCTGTCACTCACTCCCTGTAGTTACACAG

TCCAGTGAATCTTGCCAACTCAAGTCGTTTGTACATTTTCTGGTACTTTTATATCATTGTTTTATTTCATAAAGTAATGACACTGTTTATCTGTTGTGGA

CAACTTGTTGATGGTTCAAGAAGTAATGACGGATTCTACCATGGGGCTTCTACCTGACTGCTGTTCCCATTTGAGTATGGCGTTTGTTGTTGGTTTTTGT

TTTTGGTGCTGAGGATTAAATTTAAGGGTTTTTGTATTATAGGCAAATGTCTTGTATCCTAGTATATACACAGGCGTTGTGTTTTACTAATTATTTGCAG

TGGTACGTATCAAATCCAAGATCTCGTGCATTCTATGAACATGCTAAACCACAGAGCGAGAACCCCCATCCTGTTTTTGAGGCAGGGTCTGGTATATTGC

TTAGGCTACTCCTAATCTCCTTCCAGAATTTTGTAATCCCCGTCTCAAGCTCCTTCAGTACTTACAGGTATTTGCTACCACACTGAGCAAGGTCATCTTT

TAATATTTTTTGAGTACCTATTTTTAACTTTAGTAGCAAGTTTTTAAAATGCACATTTTACTTAATGTTATTTTGCAGATTATGAGGTTTGTTTAAAATT

CCTTCATAATGTAAATATTTGTATAATAATATATTATTCAGGTACATTTTCTGATGAATTGTATTTTTAATTCAGAAGGTAAGGATCCTAGTTTTGTACT

TTTTAAAAATATAGTTGCATACCTGTTTACAAATGTGTATAAAGATGTGTTTTTACCTCTTGTTCAACCTACCTTCTTGAATTAGTTAGTAAATTGATCT

AATTAAAGCTAAATGCTTGGTGTGTTAAA
Translation
MVGVLSMAAAAAPLPVKDYEIE - UNI22312 - PCKKRRKDDDNSSCETITKYLSPIGKTGDKVFSPPKPSNILHYFRKTSLTTEKPQSTKAYKIKP

SPPLLVGNSKDCKTPLEVFSNREFKRKRKRVSLSSQLNDIKIQDECPVEISNNDSKEDGGLSDCVESSASVSLYKEHVEVLAESIEDSRNQPNTKSSKKK

VNPKQCTTKSDDRILRKRKRSKVTGQSESVPLADELSLPEDGGKDSKLTKPSLAEENDSRTHATKRADLKESTITVSYEEFVKSHKAAKVEEIPDPAVPA

CVPSGPGEAVKSGSEGELSGSCEPSPQLHLKTVTVLAQVHPTPPKKKGKIPPIFLKQKQPELENSLSDPENEQPVQKRKSNVVIQEGQLELAVLEAWNSE

ASVPKCSMEERQQFMRAFRQPPPDTLKNGFKKPLEKQKDPSEKSVHEGDSSSEKIIENPNIQRVSSQGCLQSHADRGSFPKEKSKKPNKKGKKTRTTAGG

NREENIQKEKTAFSLKDEQDQNSLRRSVRQKSEVLKSNALLNSENLVCEDTAHDSVQMSLCNRNKSRSSSTPTRDMVTHHRAEPGSSLEYVSTRQPIRRS

LRSCSTPATNALGGTESEDAQDTIPVKASTPKSARTSEKHNLYTAELIIVSSDSESPIR - UNI22808 - RMKFTRISTPKKSKKSSKKSETTEEEL

TSQKKK ANSTSKNISKAKELIEEAKAFQIGGSKTEETVVPLRRSSRHQARSAKEKSPEID - UNI21836 - DSVIVIDSSPTSIREPEKSQKKLQN

LNDVLGKKLNKSSKNVPG GKMKIAPLFLAKRTKRAAIPVFDLDESS - UNI1160 - SQDSSEQTQDCDVQFKAKRDFLMSGLPDLLKRQIAKKAAA

LDVYNAVSTSFQRVVHVQQKDDE EYWLWHLKPPSCPLLTEFKELNTKVTDLSEYVVAFGEFSTLNPNPRSNPAAV MMRTRKDFTKEVRNLLLEEIKCS

NPEFSLEKYFPLLLKKRIEHQVLCEGHGKQA ASPQLQPDVSQKETKRKQVATGNQKSKRKRQNEYSVSPEEMKGRSKDLDERISSSCTNLDPSRD DSG

TEDMLWTEKYQPQNSNELIGNELAVKKLHS SWLKDWKRRAELEERHNLKGKRDEKEED DLSDSTDFKGSSDDEENRLCNTVLITGPTGVGKTAAVYAC

AQELGFK IFEVNASSQRSGRQILSQLKEATQSHQVDKQGVNSQKPCFFNNYNIGKSPK - UNI12426 - KKLNSPGKVVTSPRKLPPSSPKTSGQK

RALLPKTLANYFKVSSKSKSNDDVGALMGDDKG GVKNSSLEQRQLIQTKSTNANNSHIKDVGAEESNRKKATSLILFEE VDVIFDEDAGFLNAVKTFM

ATTKRPVILTTSD - UNI12087 - DPTFSLVFDGCFEEINFSIPSL - UNI8251 - LNVASYLQVICLVENFRTDFKDFVTLLTANACDIRKSI

LYLQFWIRSGGGILEERPLSHCR - UNI17895 - RENSRNTLVCSEDGSDANINSKKPKRNRVALPRCDTGCAEALFGLKNIASPSQDLLSLLK - 

UNI13502 - HKITTKEEWQKLIQVLTEFHVQNIDLLHSNLEVILPLPVHVVPDVRGAYGFPVTTQASAPASMGHLTRKQSKDQPLRKSQKRKQKKMVI

LDDSDLFDTGLDFSGELPSLSPAPSLSVEDNIRRDSNPEIKTQNSGFKPHSVPQPPKTLAEKKCCMLVSHCLNSLSEFMENMSFIDALLTDPGEQNELGR

SAFHWTNGRVKSGLCDEFSLENRDRWAPQSAGELKATAEALSFTECSSTISKALESLNSCKQLERDPTNELTVCVSQRRHDACFRQSAANLD - UNI30

023 - DNADKRMAVIKSVFSSRSFLTLGNKQASIIDYLPTLRNICRTEKLKEQEKNKRR - UNI13336 - RFLHYFEGIHLEIPEETITTLAADFP


For any suggestions or comments, please send an email to unitrap@crg.es