Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000017639 (Rab11fip4)
Chromosomal location
Chr 11: 79404518 - 79511524 (+)
Description
RAB11 family interacting protein 4 (class II) Gene [Source:MGI (curated);Acc:Rab11fip4-001]
RefSeq_dna
NM_175543 
RefSeq_peptide
NP_780752.1 
UniGene
Mm.130656 Mm.473016 Mm.473716 
MGI
MGI:2442920 
Uniprot/SWISSPROT
Q8BQP8 
Uniprot/SPTREMBL
Q5SYH4 
Human Ortholog
ENSG00000131242 (RAB11FIP4)
Omim not available
UniTrap UNI37587
Vector Insertion
Chr 11: 79404937 - 79433130
Public Clones (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30528
Vector Insertion
Chr 11: 79434058 - 79474328
Public Clones IST11294G4 (tigm) IST13955G6 (tigm) IST14312C6 (tigm) IST14620D11 (tigm)
IST12474E4 (tigm) IST12508E9 (tigm) IST14778D10 (tigm) IST14758F11 (tigm)
IST14958D6 (tigm) IST13130E9 (tigm) IST14778D6 (tigm) IST13301F8 (tigm)
IST10229G4 (tigm) IST11069B8 (tigm) IST11816D2 (tigm) IST13361E7 (tigm)
IST14722F6 (tigm) IST14722E3 (tigm) IST14557B8 (tigm) IST14313D5 (tigm)
IST14220F11 (tigm) IST13479G10 (tigm) IST12464B7 (tigm) IST14830E3 (tigm)
IST12596D4 (tigm) IST14862C6 (tigm) IST13849H9 (tigm) IST10732E11BBF1 (tigm)
IST12800F2 (tigm) IST15086A11 (tigm) IST14759F4 (tigm) IST14607D4 (tigm)
IST10830G5 (tigm) IST14959H7 (tigm) IST10732E11 (tigm) IST14813F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20684
Vector Insertion
Chr 11: 79474359 - 79494289
Public Clones IST14944B1 (tigm)
Private Clones OST354922 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13710
Vector Insertion
Chr 11: 79494514 - 79496842
Public Clones CMHD-GT_268D7-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000017783
Sequence
GGGCCGCGCTGAGTTCCAACCACCCCCCACCCCCCAACTCCAGCTCAGGTCTAGGAGGGGCGGAGCCTGGGGAGGCTCGGGTCCTTTTGTCTGCAGCCCC

GCCCCGCCCCGCCCCCACGCGGGCCCGCGGCGCGCGGCAGACACGAGCGGCTGACACGAGCGGCCGCCGCGGGCGGAGGCTGCGCGCCGCAGACCCGGGC

GGTGCGAGCGCGATGGCGAAGGCGGCAGCGCGGGGCTTGGGCTAGCTGCCGGCGGCGCGGATGGCGGGTGGCGCGGGCTGGGCGGGCGCCCCCGCGGCTC

TGCTGCGCTCCGTGCGCCGCCTGCGCGAAGTGTTCGAGGTGTGCGGCCGCGACCCCGACGGCTTTCTACGCGTGGAGCGCGTCGCGGCGCTCGGCCTGCG

CTTCGGGCAAGGAGAGGAG GTGGAAAAACTTGTGAAGTGTTTGGATCCCAATGACCTGGGGAGAATCAACTTCAAGGATTTTTGCCGCGGAGTATTCGC

CATGAAAG GGTGTGAGGAGCTGCTGAAGGACGTGCTGTCGGTGGAGAGCGCAGGGACCCTGCCATGTTCTCCAGACATCCCAGACTGTGTGGAGCAG -

 UNI20684 - - UNI30528 - GGCAGCGACTTCTCTGGCTCTACTGATGGCGAGCAACTCCCCAGGGAACCCGACTTCTTCCAGGAAGACGAAGAG

GAAGCGATGACATTGGCCCTACCTGAGGGACCCCAGGAGTTAGACATGGACAGTCCCATGGAGAGCAGCCAAGGCCCGGAGGGCTCTGTCAAGGGTTGTG

GCGAGGAGAAGGAGCCTGAGCTGGGGGGCCTGTTCCTGCCAGAGGACAA - UNI13710 - GTGCCTCGTCCTCACTCCATCTGTGACCACATCAGAC

CTTTCCACTCACTCCACCGCCTCTCTTATCAGCAACGAGGAGCAATTTGAAGACTATGGCGAGGGGGATGACGTGGACTGTGCTCCCAGCAGCCCATGCC

CCGACGATGAGACCAGAACCAATGTCTACTCAGATCTGGGATCTTCAGTGTCTTCCAG TGCGGGACAGACCCCAAGGAAGATGCGACATGCCTACAACA

GCGAGCTGCTGGACGTGTACTGCTCTCAGTGCTGCAAGAAGATCAACCTGCTGAATGACCTGGAGGCCCGGCTGAAGAACCTGAAGGCCAACAG CCCCA

ACCGGAAGATCTCAAGCACAGCCTTTGGACG GCAGCTCATGCACAACAGTAACTTCAGCAGCAGTAATGGCAGCACCGAGGACCTGTTCCGTGACAGCA

TCGACTCCTGTGACAATGACATCACAGAGAAG GTGAGCTTCCTGGAAAAAAAGGTAACAGAACTGGAGAACGACAGCCTGACGAGCGGGGGCCTGAAGA

GCAAGCTGAAGCAAGAGAACATGCAGCTGGTGCACAG GGTGCACGAGCTGGAGGAGATGGTGAAGGATCAGGAGACCACAGCGGAGCAGGCGCTGGAGG

AGGAGGCCCGGCGACACCGTGAGGTCTACTGCAAGCTGGAGCGGGAAAAGAGCACAGAGCTGGAGCTGCTCAACACCAG GGTGCAGCAGTTGGAGGAAG

AGAACACAGATCTGAGAACGACAGTGGCTCGACTCAAGTCACAGACCGAGAAGCTGGACGAG GAGCGGCAGCGCATGTCTGACCGGCTGGAGGACACCA

GCCTGCGACTGAAGGACGAGATGGACCTTTACAAGCGCATGATGGACAAGCTGCGGCAGAACCGCCTGGAGTTCCAGAAGGAGCGGGAGGCGACGCAGGA

G CTCATCGAGGACTTGCGGAGAGAGCTGGAGCACCTGCAGATGTACAAGCTGGACTGCGAGCGGCCAGGTAGGGGCCGCAGCTCCTCTGGCCTTGGCGA

GTTCAACGCCAGAGCCCGGGAGGTGGAACTTGAACATGAGGTCAAGCGTCTGAAGCAG GAGAATCACAAGCTGCGGGATCAGAATGATGATTTAAATGG

GCAGATCCTGAGCCTCAGCCTCTACGAGGCGAAGAACCTCTTTGCAACCCAGACCAAAGCCCAGTCTCTGGCTGCAGAAATCGACACAGCATCTCGAGAT

GAG CTAATGGAGGCCCTGAAGGAGCAGGAGGAGATCAACTTCCGACTGAGACAGTACATGGACAAGATTATCCTGGCTATACTGGACCACAACCCCTCC

ATCTTGGAGATTAAACACTGAGTCAGGGTTGGCTGCAGAGCGGCCGTCGGACCTGGGACCTAAGGGCAGGCCTGCCTGAGGACGAAGAAAGATGCAGGCT

TTGCCCACATGCACTCTGTGATTGTACCTCTGAGCACCCTCTCTGTGTGTGCTGGTGTCCGTGCAAGGAGTGAGCTTGGGGCCATGGCTGTGGGTGACAA

CCCACGGTGAGCTGTGTGTGCACTTTGTAGCCCCTTTGTGAGGGGCAGAGGGGGCTGGATGTGGGGGAGACACTCTCAGGAGTTAACAGCAAGGCCTGGA

AGCTTGCATTTAGGATACTGATGAAATGATTCTACCTCTGGGATAAGGGTTAGAAGATACTCTCAGGAGATGGGTTCTCTCCCCTCCCCCACTGAAGTGG

GGACAAAACTGTTACATTCTCCAGAATTTGGTGTCCTTGCCAACCTTTCAGGCCACCTTTCAAGCCGGGTTTTTTTGTTTTGTTTTCTTTAGCTCAGAGG

AGGAAGGGGTATTGGAGAGGCCCCTGAGGTCTAGCCCCCTGGGGTGCAGATAAGCAGGTCCAGTGGACTCGGACTTACAGAGCAGTTAGAGTGCACTGTC

CATGCCTTTGGGCTAAGTCCATCGTAGTTTTCTGAGCCCCTCCCAGTCTTGCTTGCCTACCTCCCCTTTCTGGTTTGGCTTTGCTTTGTTTTGAAGATGG

AAAATACAAGCAGCATTCAGCTGGGGGTGGAAGGAAGGCCAAGAAGGGTAGGGTGCCCCAAGGCAGGTGTGTGTTAGCACTGGGGGCCAAAAGGAGTGAT

TGCCTGGGAGAGAGGTGTGTTTTCATGGCTGCATCGTCACACATGACCTCTCTGGGTTCCATGCTCCTTGGTGAGGACAGGCCTAGGGAAGGGTTTGCAG

GACTGATACCCTTGCCTCGGCTTTCAGACCCATCTGAATCAGGTCCCCAGTTAGAGAGCCGACACGGCTGGCAGGAGGTCCAGTGGAGAATACTGGGGGA

ACCTTAGTCTTCGGTTCCGTCAATACATGATGGGAATTCACATACACACACCCGTGTTGGGGGTTGAGGGAGGGTTAAAATGTGATCTGGGAGTAGGTAC

TGTATAGAACATTCCGGTTTATCTCAGTTTTATACAGCTTGTGATTGGTTGGCTTCCTTACCCCAGCTCCTATAAAGGTGTATGGTTCAAGTTTCCCCTT

CAGTTTGTTTTCTTGAGCACATCTTGTGTAAAAAGGAAGGTTTAGGGATGCTGGGGAGGCTAGCGAACAGAAAGGAGGCACAGTTGAAAGAAAATAGGGG

ATCTAGGGTGTGTGCCCCGGGGTGTGTGCCTGCTTGGCAGAGACGGGGCTTCGGTCAGTTTCAGTCCAGTCATGGTGCTTTCTTTGGCTTTTGAGACTCC

CTGTAATCATGTGCTTGGAATTCATCTCATGCTGCATAGATAGTGCGTGGGCCTGGTCTGCCTGGATGAGCCACACCAGGAAGACAGGAAGGCTTGATCT

GGGGATACGGGGTTTCCTTCCCTGGCGTCTGGGAAGATAGAGAAAAAGGGGGCTGGGTAGGGAGTCTTGTGAGGAACAATGGGAAGATAACCATGGCTTG

AGGTTGGTCCGTGTGCCGTGCTAGCAGAATGCAGAGGCCAGCTGAATATAGGTCCTGGTAAGAGGGGCCTACGCTCAGGTGAGCAGTTCAGACTTGAAGT

TGTATGGGCCGCCCGCTTCACTTGTATGTGGGTTTCCAGAGAAGGCCACAGAGACCAGAGTCAGTGTCACAGAAGAGGAAGGAGTCTGTCAGGGAAACAG

GCAGGGAAGGAAGGCTTTAGGCCCAAGTTGTAGGGCTGGAAGAGTGGACTCCCTGAGGACATGACCAGGTTTGGAGGCCCCTGTGGATCTGGACGCTTGC

TATCTAGGCCTCTGGAAGAATGATTTCTGAATGTGGTCTGACTTCCATGTAACACACCTCAGGCGAAATCCAGCCTTCTTACAGAATACACTTAGAAAAC

TCTGTCAACTTCCCCATAAGATCATGTTTGCTGTTTGCTGTTTCTTGTAGTGGTGACAGTAGGTTTCTGGTTTTTTTTTTTTTTTTTTCTGTTCTGGGTT

AGAAGGCCCAGGGGTCCCAGTGCCACACCACCCATGGGAGGTTCCAGAACTTCCCTTGCTTGGCAAGAATCTAATCTCTCTTTCTACTGCCTCCCTGGCT

CTCGCTCCAGTTGAGCTCCCAGAGACTTTCGGGAGTCTAGAGCTTACACTTGGCATTCAGTTACATTTGGATTGCAGATAAACAAGAGGTTTTAGAATCA

CCGTGTTCCATGCTATACCTGGTTAGAAAGCGTTTTTACCATTCTGATCCTCACGTGTTCTGACAGTTGGTAGAGGTGTGGCCCAGGCCTTGGAATGCTT

TAAGAATGCCACAGGTGACGCTAATTTAGTTAGGTCTCCTGTGAAGAGGGTGTGGCTCTTTCTAAGTTGAAGGGTCTGCAGTGATTTGCCAAGGTCCAGG

AAGGTTGGGGCCGTGAAGGAAGTACACCTTTCATGTGACACTTAGCCATCCTTGTATTCCACTGGGAGCCAAACAAGATGAGCTTCTGTCTCCCTGATTT

GTTTCCTTTTATTTTTGAATTAGCCACTTTTTTTTAGACCAGTAGTTTTCTTTGAGACTCTACAGAGGAAGTTCCTTTTGAAAATTTTATTTCTGATATA

CTAAAACCACAAATCTCAAGGACCAAGCAGAACGCCAGGCCTTGAGCCTGAGTCTGCCAGTTTGGCAGTGTGCTGGTGTCATACCTGATGCTGGAGGGCC

TGGGAGTGGAACACAGGAGTGGCGTGCCTGGCATGAGGTTCAGTCCCTGGCAGCATGGAAGAAAGTTGATGACAGAACCACCTCTGACTTCCATATATAA

TTGGTAGCACAGTGTGGCCCGGCACCTGTGTCTTCAATGGCCTTCCCAAGTGTTGTTCATGCACAGATCAAGGTGGAGGCCCGTAAATCATGTGAAATGT

CTGCTGAGGTCAGCAGGGCTGGAGAAGCTTGTGTGTGGCCCAGAGGATGGGTAATTATGCCACTGAGTGGTCCTTGCCCTGAGAGTCCAGCTGTTCCCAC

TACTCTGAAAGTCTCACCCTAGACGGACAGGATATAAGTGCCAGCATTTGACTGGGCATAGGCCCATTAGGAATTGGAGGCAGGTAGGCGGGAAGAGCTG

GACCTTGAGAGCAGCCTAGACGCAGTGGCCACTTGTCTCCGCGGGCTTTGTCCATTTCATAAGGGTGTCTCAGTTGCTTCCCTGTCAGTGCCAAATCAGC

AGCACCCAGCCCACACTCTGGAGAACTCTAGGTGATGGTCTGATAGCTAGTTAGTCCTGAGTTGTGGTCCTTCTGCTTCTGATGGTCCTGGGGCTGTTGG

TACATACCGGGCTGTGTAAGGGATCCAGAGACTCTACAGCAAGGCCTAAAGAATAAGGAGGACTTCACTCATCTGAGGGGCATTGGCAAATCTACACCTG

TCTAGATAGGACTGATGGGAGTGGGAAAGGTACAGGGTGGTCACCAGGCTAGTCACCAGGATGTCCAGTGACTCTGTCGAGGTCCAGGTGAAGCTCTTTA

GGGCCTCAGTGATGCCTGTTATCCCCAGTCTTTCCTCACTGGGGCCCAGCGCTTCCCTCTGGTGGCTCCTCAGGCTGGTATCACTAGCATGCGCTTGACG

AGGGGCCTCCAGTTAGAGCAGCCAGATCTTGGAAAGGACCTCCCTGTCCTGACTTGGACCCTGACAGAACGTACTTGCAATGGGTTTATCAGGAAAGGGT

AGAGGTAGCACCTTCAGGGCGGGGCAGCTCTGTGGCTCTGTCGCTCTGTCATCGTTAGCTCTGTGGCTCTGACATCGTTAGCTCTGTGGCTCTGACATCG

TTTAGCTGCTCTGCTAAGAAAAAAAGCCACTTGCAGAAAAGGCTTTGTTTCTGGAAGCATAGTCAGGTTACCAGCCTTGTCGCTCTGTGCACTAGGGGCT

GGGTAGCTTTGGTGTTCCTTCCTTGTGGACTCCTCCTCTTCCCATTGTGACTGTATCGTAGGGATGTGCATTCCTGAGGTACCATATGGAGGACAGAGTC

CCAGGCCACCTCTCCTGCAGGCCTAACTTCTGGTGGCCCTGTCTCGTGTTGGGACTGTCTTCTTTACCGTTCTGCACTGTTTCTTGTCTGCATGGTTTGG

GGTCCTCGTGCCTTTTTACCTTGTTACCACCACACAGGATTCTCTGTTACCCACTGCCCCCTTTTGTACGTCCCCTTCCCCCATCTCCCCCAGTCCTGTG

CGTACTCACGTGTGCAGCCATATGGCTCAACTGAGGCCAGCTGGCAAACACTTTACCCCACACCAGGCCGACTTCCCATAGCTCCCCAGCTCTGTTGACT

TGGTAACTTTTGTACAGGATTTTGTTACAATCTTAAGCATAGGGACCACTTAATCCCCATGTACCTGCAGCTAGTTTAGAAGCCCTGCATCCCAGACAAG

GGTAGCTTTGTGCAGACCAGCCTCTCCCGCAAACCTCTTCCTCGTGGGTTCAGGTATTTATAAAAGACAGATTTCCTTTAAAATGAGGCCCTGGCCCTAG

CAGGGAGGTGACAGGTCTACAAAGCTCTGTGCATGGCTCTTCTGGAGGAAGCCCCAGCCATGTGGTTTCCAGTGCTTGGCAATACATCTGGGTTTAGGGC

CATTGCCTCTCGTGTCTCCCCTGATTTGTGCTGAAGGAAGTCACTTGCCACTGTCCCTGCCTGCTGTCACTACCTGTCCAGCCCTTCCTTGTTTGCTGGT

GCTCAGACCAGAGTGCCATTAATCACCAGACCAACGTCAGGACCTGCACAGGACAGAGTGCGCTGAGGACTCTCGGCCGGCTGCCTCCCAGCTTCAGCTC

CCATGGGGCTGGGCCTTCTGGGGTCCAGGTGGAAGAAGCTATAGGCAGATAGGCTCTGCCTTTCCAGGGATTACATCTGGGGCTTTGCCTCAGAAGCCAG

TGGTTGCAGATGGCCTTAGCTTTGGGCTTGGGAAGGAGCTTCCACTTTAGGCCCCAGGGAAGGGAGAATGGGGTACAGCCCAGGCCCTGAACTGTTTGTT

TCCACTCTGTTCTCTCCAGAAACAGGCTTTCAGTGGGGGGCACCTTCCAAGGAACTGTATTGTACAGACCACAGTGTAAATAAAAAGTTGGCTTTTTGTG

CCTG
Translation
MAGGAGWAGAPAALLRSVRRLREVFEVCGRDPDGFLRVERVAALGLRFGQGEE VEKLVKCLDPNDLGRINFKDFCRGVFAMKG GCEELLKDVLSVESA

GTLPCSPDIPDCVEQ - UNI20684 - - UNI30528 - GSDFSGSTDGEQLPREPDFFQEDEEEAMTLALPEGPQELDMDSPMESSQGPEGSVKGC

GEEKEPELGGLFLPEDK - UNI13710 - KCLVLTPSVTTSDLSTHSTASLISNEEQFEDYGEGDDVDCAPSSPCPDDETRTNVYSDLGSSVSSS SA

GQTPRKMRHAYNSELLDVYCSQCCKKINLLNDLEARLKNLKANS SPNRKISSTAFGR RQLMHNSNFSSSNGSTEDLFRDSIDSCDNDITEK VSFLEK

KVTELENDSLTSGGLKSKLKQENMQLVHR RVHELEEMVKDQETTAEQALEEEARRHREVYCKLEREKSTELELLNTR RVQQLEEENTDLRTTVARLKS

QTEKLDE ERQRMSDRLEDTSLRLKDEMDLYKRMMDKLRQNRLEFQKEREATQE LIEDLRRELEHLQMYKLDCERPGRGRSSSGLGEFNARAREVELEH

EVKRLKQ ENHKLRDQNDDLNGQILSLSLYEAKNLFATQTKAQSLAAEIDTASRDE LMEALKEQEEINFRLRQYMDKIILAILDHNPSILEIKH
Transcript ENSMUST00000092864
Sequence
ATGCGCTCCCCGCCGGCTCCCGGATGCCAG - UNI20684 - GGCAGCGACTTCTCTGGCTCTACTGATGGCGAGCAACTCCCCAGGGAACCCGACTT

CTTCCAGGAAGACGAAGAGGAAGCGATGACATTGGCCCTACCTGAGGGACCCCAGGAGTTAGACATGGACAGTCCCATGGAGAGCAGCCAAGGCCCGGAG

GGCTCTGTCAAGGGTTGTGGCGAGGAGAAGGAGCCTGAGCTGGGGGGCCTGTTCCTGCCAGAGGACAA - UNI13710 - GTGCCTCGTCCTCACTCC

ATCTGTGACCACATCAGACCTTTCCACTCACTCCACCGCCTCTCTTATCAGCAACGAGGAGCAATTTGAAGACTATGGCGAGGGGGATGACGTGGACTGT

GCTCCCAGCAGCCCATGCCCCGACGATGAGACCAGAACCAATGTCTACTCAGATCTGGGATCTTCAGTGTCTTCCAG TGCGGGACAGACCCCAAGGAAG

ATGCGACATGCCTACAACAGCGAGCTGCTGGACGTGTACTGCTCTCAGTGCTGCAAGAAGATCAACCTGCTGAATGACCTGGAGGCCCGGCTGAAGAACC

TGAAGGCCAACAG CCCCAACCGGAAGATCTCAAGCACAGCCTTTGGACG GCAGCTCATGCACAACAGTAACTTCAGCAGCAGTAATGGCAGCACCGAG

GACCTGTTCCGTGACAGCATCGACTCCTGTGACAATGACATCACAGAGAAG GTGAGCTTCCTGGAAAAAAAGGTAACAGAACTGGAGAACGACAGCCTG

ACGAGCGGGGGCCTGAAGAGCAAGCTGAAGCAAGAGAACATGCAGCTGGTGCACAG GGTGCACGAGCTGGAGGAGATGGTGAAGGATCAGGAGACCACA

GCGGAGCAGGCGCTGGAGGAGGAGGCCCGGCGACACCGTGAGGTCTACTGCAAGCTGGAGCGGGAAAAGAGCACAGAGCTGGAGCTGCTCAACACCAG G

GTGCAGCAGTTGGAGGAAGAGAACACAGATCTGAGAACGACAGTGGCTCGACTCAAGTCACAGACCGAGAAGCTGGACGAG GAGCGGCAGCGCATGTCT

GACCGGCTGGAGGACACCAGCCTGCGACTGAAGGACGAGATGGACCTTTACAAGCGCATGATGGACAAGCTGCGGCAGAACCGCCTGGAGTTCCAGAAGG

AGCGGGAGGCGACGCAGGAG CTCATCGAGGACTTGCGGAGAGAGCTGGAGCACCTGCAGATGTACAAGCTGGACTGCGAGCGGCCAGGTAGGGGCCGCA

GCTCCTCTGGCCTTGGCGAGTTCAACGCCAGAGCCCGGGAGGTGGAACTTGAACATGAGGTCAAGCGTCTGAAGCAG GAGAATCACAAGCTGCGGGATC

AGAATGATGATTTAAATGGGCAGATCCTGAGCCTCAGCCTCTACGAGGCGAAGAACCTCTTTGCAACCCAGACCAAAGCCCAGTCTCTGGCTGCAGAAAT

CGACACAGCATCTCGAGATGAG CTAATGGAGGCCCTGAAGGAGCAGGAGGAGATCAACTTCCGACTGAGACAGTACATGGACAAGATTATCCTGGCTAT

ACTGGACCACAACCCCTCCATCTTGGAGATTAAACACTGAGTCAGGGTTGGCTGCAGAGCGGCCGTCGGACCTGGGACCTAAGGGCAGGCCTGCCTGAGG

ACGAAGAAAGATGCAGGCTTTGCCCACATGCACTCTGTGATTGTACCTCTGAGCACCCTCTCTGTGTGTGCTGGTGTCCGTGCAAGGAGTGAGCTTGGGG

CCATGGCTGTGGGTGACAACCCACGGTGAGCTGTGTGTGCACTTTGTAGCCCCTTTGTGAGGGGCAGAGGGGGCTGGATGTGGGGGAGACACTCTCAGGA

GTTAACAGCAAGGCCTGGAAGCTTGCATTTAGGATACTGATGAAATGATTCTACCTCTGGGATAAGGGTTAGAAGATACTCTCAGGAGATGGGTTCTCTC

CCCTCCCCCACTGAAGTGGGGACAAAACTGTTACATTCTCCAGAATTTGGTGTCCTTGCCAACCTTTCAGGCCACCTTTCAAGCCGGGTTTTTTTGTTTT

GTTTTCTTTAGCTCAGAGGAGGAAGGGGTATTGGAGAGGCCCCTGAGGTCTAGCCCCCTGGGGTGCAGATAAGCAGGTCCAGTGGACTCGGACTTACAGA

GCAGTTAGAGTGCACTGTCCATGCCTTTGGGCTAAGTCCATCGTAGTTTTCTGAGCCCCTCCCAGTCTTGCTTGCCTACCTCCCCTTTCTGGTTTGGCTT

TGCTTTGTTTTGAAGATGGAAAATACAAGCAGCATTCAGCTGGGGGTGGAAGGAAGGCCAAGAAGGGTAGGGTGCCCCAAGGCAGGTGTGTGTTAGCACT

GGGGGCCAAAAGGAGTGATTGCCTGGGAGAGAGGTGTGTTTTCATGGCTGCATCGTCACACATGACCTCTCTGGGTTCCATGCTCCTTGGTGAGGACAGG

CCTAGGGAAGGGTTTGCAGGACTGATACCCTTGCCTCGGCTTTCAGACCCATCTGAATCAGGTCCCCAGTTAGAGAGCCGACACGGCTGGCAGGAGGTCC

AGTGGAGAATACTGGGGGAACCTTAGTCTTCGGTTCCGTCAATACATGATGGGAATTCACATACACACACCCGTGTTGGGGGTTGAGGGAGGGTTAAAAT

GTGATCTGGGAGTAGGTACTGTATAGAACATTCCGGTTTATCTCAGTTTTATACAGCTTGTGATTGGTTGGCTTCCTTACCCCAGCTCCTATAAAGGTGT

ATGGTTCAAGTTT
Translation
MRSPPAPGCQ - UNI20684 - GSDFSGSTDGEQLPREPDFFQEDEEEAMTLALPEGPQELDMDSPMESSQGPEGSVKGCGEEKEPELGGLFLPEDK 

- UNI13710 - KCLVLTPSVTTSDLSTHSTASLISNEEQFEDYGEGDDVDCAPSSPCPDDETRT          

For any suggestions or comments, please send an email to unitrap@crg.es