Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000017715 (Pgs1)
Chromosomal location
Chr 11: 117848171 - 117885325 (+)
Description
phosphatidylglycerophosphate synthase 1 Gene [Source:MGI (curated);Acc:Pgs1-001]
RefSeq_dna
NM_133757 
RefSeq_peptide
NP_598518.1 
UniGene
Mm.28864 
MGI
MGI:1921701 
Uniprot/SWISSPROT
Q8BHF7 
Uniprot/SPTREMBL
Q3U6T3 
Human Ortholog
ENSG00000087157 (PGS1)
Omim not available
UniTrap UNI23167
Vector Insertion
Chr 11: 117848328 - 117858754
Public Clones (sanger) D054G04 (ggtc) IST14182G5 (tigm) IST12503D12 (tigm) IST14182G6 (tigm)
IST14595F7 (tigm)
Private Clones OST274215 (lexicon) OST169973 (lexicon) OST68615 (lexicon) OST39597 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20476
Vector Insertion
Chr 11: 117858945 - 117861512
Public Clones E128E06 (ggtc) D128E06 (ggtc)
Private Clones OST361013 (lexicon)
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24723
Vector Insertion
Chr 11: 117862348 - 117862929
Public Clones not available
Private Clones OST208976 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24114
Vector Insertion
Chr 11: 117863030 - 117863664
Public Clones not available
Private Clones OST234233 (lexicon) OST126183 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7807
Vector Insertion
Chr 11: 117867206 - 117875960
Public Clones RRN307 (baygenomics) M076F08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23410
Vector Insertion
Chr 11: 117867206 - 117875887
Public Clones (cmhd) IST14885H1 (tigm) IST14837D7 (tigm)
Private Clones OST260800 (lexicon)
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37256
Vector Insertion
Chr 11: 117875960 - 117876037
Public Clones CMHD-GT_477D4-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15775
Vector Insertion
Chr 11: 117876037 - 117880920
Public Clones not available
Private Clones OST500052 (lexicon) OST449193 (lexicon) OST422899 (lexicon) OST422593 (lexicon)
OST364070 (lexicon) OST350791 (lexicon) OST202984 (lexicon) OST70864 (lexicon)
OST43430 (lexicon) OST39581 (lexicon)
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16513
Vector Insertion
Chr 11: 117881047 - 117884718
Public Clones not available
Private Clones OST459464 (lexicon) OST259689 (lexicon) OST97468 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000017859
Sequence
GGAAGCGGAAGCGGCGGGTCTCCATGGCGGCGCCGGCAGCGGGCCCGGTGTTCTGGAGGCGGCTGCTGGGCCTGCTGCCTGGCAGGCCCGGGCTGGCCGC

GCTCCTGGGCCGCCTCTCCGACCGTCTGGGCAGGAGCCGGGAGCGCCGGCGCCGGAG - UNI23167 - GTCACCATGGCTGTTATTGGCTCCCTTGC

TGTCCCCAACCGTTCCTCAGGTCACCTCCCCACCTTGCTGCCTATGTCCCGAGGGTGTACACAGGTTCCAGTGGATCAGAAACCTGGTTCCAGAGTTTGG

AGTCTCCAGCTCTCATGTCAGGGTACTGTCTTCCCCTGCAGAGTTCTTCGAGCTCATGAAG - UNI20476 - GGGCAGATAAAAATAGCCAAGAGGC

GAGTTGTGATGGCATCCCTCTACTTGGGGACAGGACCTTTGGAACAGGAACTG - UNI24723 - GTGGATTGTCTGGAAAGTTCTCTAGAAAAGTCA

CTCCAAGCGAAGTTTCCTTCCGACCTCAAGGTCTCCATTCTCCTGGACTTCACCAGAGGCTCAAGAG - UNI24114 - GTAGGAAGAACTCTCGCAC

TATGCTGCTCCCACTCCTGCAGAGGTTTCCAGAGCGCGTGCGCGTCTCCCTCTTCCACACACCAAACCTCCGAGGACTCCTCCGACTCCTTATCCCTGAG

CGCTTCAATGAGACCATCGGCCTCCAGCACATCAAGGTGTACCTCTTTGACAACAACGTCATCCTGAGTGG TGCAAACCTGAGTGACTCATACTTCACC

AACCGCCAGGACCGCTACGTGTTCTTGCAGGACTGCGCTGAGATTGCCGACTTCTTCACAGAGCTGGTGGACGCCGTGGGGGATGTATCCTTGCAGTTGC

AGGGCGACGACACAGTGGAGGTTGTGGATGGGATGGTGCACCCTTACAAAG GTGACCGGGCTGCGTACTGCAGAGCAGCGAACAAGCGGGTCATGGACG

TCATCCACTCGGCCAGGGCCCGGCAGCAGATGCTGCACGCACAGACCTTTCACAGTGATTCTCTGCTGAGCCAGGAAGAGGCTGCAGCTGCCGGGGACCG

GAGGCCAGCGCCCGACACCTGGATTTACCCACTGATCCAGATGAAGCCCTTTGAGATTCAGATTGATGAGATAGTCACGGAGACGCTGCTGACGGAGGCT

GAGCGCGGAGCTAAGGTCTTCCTCACCACTGGCTACTTCAACCTGACCCAGGCCTACATGGACCTGGTGCTAGGCACTCGAGCTGAGTATCAGATCCTTC

TAGCCTCACCGGAGGTGAATGGCTTCTTTGGGGCTAAGGGCGTGGCGGGCGCCATCCCAGCCGCCTATGTGCACATTGAGCGACAGTTCTACAGTGAGGT

GTGTAGCCTGGGGCAGCAGGATCGGGTCCAGCTCCAGGAATACTGGCGCAGGGGTTGGACCTTTCATGCCAAAG - UNI7807 - - UNI23410 - 

GCCTCTGGCTGTACCTGGCAGGGAGCAGCCTGCCCTGCCTCACGCTGATTGGCTCTCCTAATTTTGGGTACAGGTCAGTTCACCGGGACCTGGAAGCCCA

GATTGCCATCGTGACGGAGAGCCGGTCCCTGCAGCAGCAGCTTCATCAG - UNI15775 - GAGCAAGAGCAGCTCTACCTGCGGTCTGGTGTGGTGA

CCTCCGCAACCTTTGAGCAGCCAGGGCGGCAGGTCAAGCTGTGGGTGAAGATGGTGACCCCGCTAATCAAGAACTTCTTCTGAGAACAG - UNI16513

 - GAATGGCCTTGATGAAGATGACGGGCATGACTGGGGTCAGATCCTTCAACCGGGCTTCAGCAATGACTCCGGTCTGGGTGTCCCAGCGAGCTCCTGT

GGGGACAATGGAGCTGAGGGTCTGGGTGCCCTAGGGGAGGCAGAACCCACTGTTTGGATGCTGACCGTGAAAAAGGGAGGCACGGTAGGGAGAGAGGCCT

GGCCTCCAACCTCCCCACTCTTTTCAGAGACAGGCCAGTGACTGGGAGCCATGAAGCGTTCAGGCCAGGTGCCAGGGTCTGAGAGTGCCAAACATGGAGG

AGTGTGAACCAAGGACTCCGAGGTGACTCTGCATGCCGTAATGGCTCTGAGGCTGCATCTTCTCAGAGCTTCATCTCAGCCTTCTCAATGTCAGTGGCAG

AGAAAACTGACCGCAGCTCAGATCCCAGCAATGTTCCTTCCTGATCCCTCCTGTGTAATGTCTACTCTCTGTGTACATAGGGAATAAGTTATATATAGAT

GCACATATAAACACTATCTGCCCTTAGCCAGACTGCTGTTGTCTCTTATCCTAGCCAATGGTGTTTGTGTCCTGCGTGGCATTGGAATCACAATAAACAT

GGAGAATGGC
Translation
MAAPAAGPVFWRRLLGLLPGRPGLAALLGRLSDRLGRSRERRRRR - UNI23167 - RSPWLLLAPLLSPTVPQVTSPPCCLCPEGVHRFQWIRNLVP

EFGVSSSHVRVLSSPAEFFELMK - UNI20476 - GQIKIAKRRVVMASLYLGTGPLEQEL - UNI24723 - VDCLESSLEKSLQAKFPSDLKVS

ILLDFTRGSRG - UNI24114 - GRKNSRTMLLPLLQRFPERVRVSLFHTPNLRGLLRLLIPERFNETIGLQHIKVYLFDNNVILSG GANLSDSYFT

NRQDRYVFLQDCAEIADFFTELVDAVGDVSLQLQGDDTVEVVDGMVHPYKG GDRAAYCRAANKRVMDVIHSARARQQMLHAQTFHSDSLLSQEEAAAAG

DRRPAPDTWIYPLIQMKPFEIQIDEIVTETLLTEAERGAKVFLTTGYFNLTQAYMDLVLGTRAEYQILLASPEVNGFFGAKGVAGAIPAAYVHIERQFYS

EVCSLGQQDRVQLQEYWRRGWTFHAKG - UNI7807 - - UNI23410 - GLWLYLAGSSLPCLTLIGSPNFGYRSVHRDLEAQIAIVTESRSLQQQ

LHQ - UNI15775 - EQEQLYLRSGVVTSATFEQPGRQVKLWVKMVTPLIKNFF - UNI16513 - 
Transcript ENSMUST00000100185
Sequence
ATGGCAGGCAGT - UNI24723 - GTGGATTGTCTGGAAAGTTCTCTAGAAAAGTCACTCCAAGCGAAGTTTCCTTCCGACCTCAAGGTCTCCATTCT

CCTGGACTTCACCAGAGGCTCAAGAG - UNI24114 - GTAGGAAGAACTCTCGCACTATGCTGCTCCCACTCCTGCAGAGGTTTCCAGAGCGCGTGC

GCGTCTCCCTCTTCCACACACCAAACCTCCGAGGACTCCTCCGACTCCTTATCCCTGAGCGCTTCAATGAGACCATCGGCCTCCAGCACATCAAGGTGTA

CCTCTTTGACAACAACGTCATCCTGAGTGG TGCAAACCTGAGTGACTCATACTTCACCAACCGCCAGGACCGCTACGTGTTCTTGCAGGACTGCGCTGA

GATTGCCGACTTCTTCACAGAGCTGGTGGACGCCGTGGGGGATGTATCCTTGCAGTTGCAGGGCGACGACACAGTGGAGGTTGTGGATGGGATGGTGCAC

CCTTACAAAG GTGACCGGGCTGCGTACTGCAGAGCAGCGAACAAGCGGGTCATGGACGTCATCCACTCGGCCAGGGCCCGGCAGCAGATGCTGCACGCA

CAGACCTTTCACAGTGATTCTCTGCTGAGCCAGGAAGAGGCTGCAGCTGCCGGGGACCGGAGGCCAGCGCCCGACACCTGGATTTACCCACTGATCCAGA

TGAAGCCCTTTGAGATTCAGATTGATGAGATAGTCACGGAGACGCTGCTGACGGAGGCTGAGCGCGGAGCTAAGGTCTTCCTCACCACTGGCTACTTCAA

CCTGACCCAGGCCTACATGGACCTGGTGCTAGGCACTCGAGCTGAGTATCAGATCCTTCTAGCCTCACCGGAGGTGAATGGCTTCTTTGGGGCTAAGGGC

GTGGCGGGCGCCATCCCAGCCGCCTATGTGCACATTGAGCGACAGTTCTACAGTGAGGTGTGTAGCCTGGGGCAGCAGGATCGGGTCCAGCTCCAGGAAT

ACTGGCGCAGGGGTTGGACCTTTCATGCCAAAG - UNI7807 - - UNI23410 - GTCAGTTCACCGGGACCTGGAAGCCCAGATTGCCATCGTGA

CGGAGAGCCGGTCCCTGCAGCAGCAGCTTCATCAG - UNI15775 - GAGCAAGAGCAGCTCTACCTGCGGTCTGGTGTGGTGACCTCCGCAACCTTT

GAGCAGCCAGGGCGGCAGGTCAAGCTGTGGGTGAAGATGGTGACCCCGCTAATCAAGAACTTCTTCTGAGAACAG - UNI16513 - GAATGGCCTTG

ATGAAGATGACGGGCATGACTGGGGTCAGATCCTTCAACCGGGCTTCAGCAATGACTCCGGTCTGGGTGTCCCAGCGAGCTCCTGTGGGGACAATGGAGC

TGAGGGTCTGGGTGCCCTAGGGGAGGCAGAACCCACTGTTTGGATGCTGACCGTGAAAAAGGGAGGCACGGTAGGGAGAGAGGCCTGGCCTCCAACCTCC

CCACTCTTTTCAGAGACAGGCCAGTGACTGGGAGCCATGAAGCGTTCAGGCCAGGTGCCAGGGTCTGAGAGTGCCAAACATGGAGGAGTGTGAACCAAGG

ACTCCGAGGTGACTCTGCATGCCGTAATGGCTCTGAGGCTGCATCTTCTCAGAGCTTCATCTCAGCCTTCTCAATGTCAGTGGCAGAGAAAACTGACCGC

AGCTCAGATCCCAGCAATGTTCCTTCCTGATCCCTCCTGTGTAATGTCTACTCTCTGTGTACATAGGGAATAAGTTATATATAGATGCACATATAAACAC

TATCTGCCCTTAGCCAGACTGCTGTTGTCTCTTATCCTAGCCAATGGTGTTTGTGTCCTGCGTGGCATTGGAATCACAATAAACATGGAGAATGGC
Translation
MAGS - UNI24723 - VDCLESSLEKSLQAKFPSDLKVSILLDFTRGSRG - UNI24114 - GRKNSRTMLLPLLQRFPERVRVSLFHTPNLRGLL

RLLIPERFNETIGLQHIKVYLFDNNVILSG GANLSDSYFTNRQDRYVFLQDCAEIADFFTELVDAVGDVSLQLQGDDTVEVVDGMVHPYKG GDRAAYC

RAANKRVMDVIHSARARQQMLHAQTFHSDSLLSQEEAAAAGDRRPAPDTWIYPLIQMKPFEIQIDEIVTETLLTEAERGAKVFLTTGYFNLTQAYMDLVL

GTRAEYQILLASPEVNGFFGAKGVAGAIPAAYVHIERQFYSEVCSLGQQDRVQLQEYWRRGWTFHAKG - UNI7807 - - UNI23410 - GQFTGT

WKPRLPS - UNI15775 -  - UNI16513 - 

For any suggestions or comments, please send an email to unitrap@crg.es