Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000017756 (Slc12a7)
Chromosomal location
Chr 13: 73870542 - 73954200 (+)
Description
solute carrier family 12, member 7 Gene [Source:MGI Symbol;Acc:MGI:1342283]
RefSeq_dna
NM_011390 
RefSeq_peptide
NP_035520.1 
UniGene
Mm.275800 
MGI
MGI:1342283 
Uniprot/SWISSPROT
Q9WVL3 
Uniprot/SPTREMBL
Q8C6Y2 
Human Ortholog
ENSG00000113504 (SLC12A7)
Omim not available
UniTrap UNI35482
Vector Insertion
Chr 13: 73870786 - 73901150
Public Clones IST12838G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5423
Vector Insertion
Chr 13: 73901339 - 73921966
Public Clones (sanger) CSJ197 (baygenomics) CSJ173 (baygenomics) E003C02 (ggtc)
E078G05 (ggtc) D174D08 (ggtc) E068G04 (ggtc) E080G01 (ggtc) E077E08 (ggtc)
A052D04 (ggtc) E003C03 (ggtc) E076B07 (ggtc) CMHD-GT_326D4-3 (cmhd) IST15081A11 (tigm)
IST12304E8 (tigm) IST13171A1 (tigm) IST14826A8 (tigm)
Private Clones OST148165 (lexicon) OST60617 (lexicon) OST60616 (lexicon) OST53971 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9973
Vector Insertion
Chr 13: 73943058 - 73943476
Public Clones XD074 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000017900
Sequence
CGGAGTCCGGCGGCTGCTCTGGAGCAGCGTGTGGCTGCGAGGGACAGCAGAGTCTAACGGAGCCATGCCCACGAACTTTACGGTGGTGCCGGTGGAGGCG

CGCGCCGACGGCGCCGGGGACGAAGCTGCTGAGCGCACGGAAGAACCCGAGTCTCCCGAGAGCGTGGATCAAACCTCCCCTACGCCGG - UNI5423 -

 GAGATGGAAACCCCAGGGAAAACAGCCCTTTCATCAATAATGTGGAGGTGGAAAGAGAGAGCTACTTCGAGGGGAAGAACATGGCACTTTTTGAG GAA

GAGATGGACAGCAACCCCATGGTGTCATCACTGCTGAACAAGCTGGCCAACTATACCAACCTGAGCCAGGGTGTGGTAGAGCATGAGGAAGATGAGGACA

GCCGGAGGCGAGAGGTCAAG GCCCCACGCATGGGCACCTTCATCGGAGTCTACCTGCCGTGCCTGCAGAACATCTTGGGTGTTATCCTTTTCCTGCGTC

TGACCTGGATTGTGGGGGCAGCTGGTGTTATGGAGTCCTTCCTCATTGTGGCCATGTGCTGCACCTGT ACAATGCTGACAGCCATCTCCATGAGCGCCA

TCGCTACCAACGGCGTGGTCCCAG CGGGAGGCTCGTACTACATGATCTCCCGTTCGCTGGGGCCTGAGTTTGGAGGTGCTGTTGGCCTCTGCTTCTACT

TGGGCACGACATTTGCAGGCGCCATGTACATCCTGGGTACCATCGAGATCTTCCTG ACCTACATCTCTCCAAGTGCGGCCATCTTCCAGGCAGAGACGG

CGGATGGCGAGGCGGCCGCACTGTTGAACAACATGCGTGTGTATGGCAGCTGTGCCCTGGCACTCATGGCGGTGGTGGTCTTTGTTGGTGTCAAATATGT

CAACAAGCTGGCACTGGTCTTCTTAGCCTGTGTTGTGCTTTCTATCCTGGCCATCTATGCTGGTGTCATCAAGACAGCCTTTGCCCCACCTGACATCCC 

GGTCTGCCTTCTAGGGAACCGCACGCTGGCAAATCGCAACTTTGATACCTGTGCCAAGATGCAGGTTGTCAGCAACGGTACAGTGACCACTGCACTCTGG

CGCCTCTTCTGCAATGGCTCCAGCTTGGGTGCCACCTGTGATGAGTACTTTGCACAGAACAACGTTACTGAGATACAGGGCATCCCTGGTGTGGCCAGTG

GTGTCTTCCTGG ATAACCTGTGGAGCACATATTCAGACAAGGGGGCATTTGTGGAAAAGAAAGGTGTGTCCTCAGTGCCTGTGTCCGAGGAGAGCCGGC

CTGGTGGATTGCCATACGTCCTCACAGACATCATGACCTACTTCACCATGCTAGTTGGCATCTACTTCCCGTCTGTAACTG GGATCATGGCAGGATCCA

ACCGCTCCGGGGACCTCAAAGACGCCCAGAAGTCTATTCCAACAGGGACCATTCTGGCCATCGTGACTACATCTTTCATTT ATCTTTCCTGCATAGTGC

TGTTTGGGGCCTGCATTGAAGGTGTAGTCCTGCGAGATAA GTTTGGGGAGGCCTTGCAAGGGAACCTGGTCATTGGCATGCTGGCCTGGCCATCTCCCT

GGGTCATTGTGATTGGCTCCTTCTTCTCCACCTGTGGTGCTGGCCTGCAGAGCCTGACTGGGGCACCCCGCCTACTGCAGGCCATTGCGCGTGACGGAAT

CATCCCCTTCCTACAG GTGTTTGGTCATGGAAAGGCCAACGGGGAGCCCACATGGGCCCTGCTGCTCACGGCTCTCATCTGTGAGACCGGTATCCTCAT

CGCCTCCCTGGACAGTGTGGCCCCCATCCTGTCCAT GTTCTTCCTCATGTGCTACATGTTCGTCAATCTGGCCTGTGCCGTACAGACCCTGCTACGCAC

ACCCAACTGGCGTCCACGCTTCAAGTTCTACCACTG GACCCTCTCCTTCCTTGGGATGAGTCTCTGCCTCGCGCTGATGTTCATCTGCTCCTGGTACTA

CGCCCTTTTCGCCATGCTCATTGCCGGCTGCATCTACAAGTACATCGAGTACCGCGG GGCTGAGAAGGAGTGGGGGGATGGCATCAGGGGCCTGTCACT

GAATGCTGCCCGCTACGCCCTGCTGCGTGTGGAACATGGGCCCCCACATACCAAGAACTGGAG GCCCCAGGTGTTGGTGATGCTGAACCTGGACTCGGA

GCAGTGTGTAAAGCACCCCCGCCTGCTGTCCTTCACCTCTCAGCTGAAGGCTGGCAAGGGCCTGACCATCGTGGGATCTGTGCTAGAGGGCACCTACTTA

GACAAGCATGTGGAGGCCCAGAGGGCTGAAGAG AATATCCGGTCTCTGATGAGTGCAGAGAAGACGAAGGGCTTCTGCCAGCTGGTGGTGTCCTCCAAC

CTGCGAGATGGTGCGTCCCACCTGATCCAGTCGGCTGGCCTCGGTGGCATGAAACACAACACTGTCCTCATGGCCTGGCCAGAGGCTTGGAAGGAGGCAG

ATAATCCTTTCTCCTGGAAGAACTTTGTAG - UNI9973 - ACACAGTCCGTGACACTACAGCAGCACATCAGGCCTTGTTGGTGGCCAAGAACATTG

ACTTATTCCCACAAAACCAAGAGCGCTTCAGCGACGGGAACATTGATGTGTGGTGGATCGTGCATGACGGGGGCATGCTCATGCTTCTGCCCTTTCTGCT

GCGCCAGCACAAG GTGTGGCGAAAGTGCCGGATGCGCATCTTCACTGTGGCCCAGGTGGATGATAACAGCATCCAGATGAAGAAGGACCTGCAGATGTT

CCTGTACCACCTCAGGATCAGTGCCGAGGTGGAGGTGGTGGAGATG GTTGAAAATGATATTTCCGCATTCACCTATGAGAAGACGCTAATGATGGAGCA

GAGGTCACAGATGCTGAAACAGATGCAGTTGTCAAAGAATGAGCGGGAGAGAGAG GCCCAGCTGATTCATGACAGGAACACTGCATCCCATACCACAGC

AACTGCTAGAACCCAAGCCCCACCAACACCCGACAAAGTGCAGATGACATGGACGAAAGAGAAACTCATTGCAGAGAAACACAGGAACAAGGACACTGGC

CCATCAGGCTTCAAAGACCTCTTCAGCCTAAAGCC GGACCAGTCCAACGTCAGGAGGATGCATACTGCTGTGAAGCTCAACGGCGTAGTTCTCAACAAG

TCCCAGGATGCCCAACTGGTCCTGCTGAATATGCCAGGCCCCCCAAAAAGTCGGCAGGGGGACGAGAACT ACATGGAGTTCCTCGAGGTCCTGACGGAA

GGGCTGAACAGGGTCCTCCTGGTCAGGGGTGGTGGCCGAGAAGTCATCACCATCTACTCCTAACACCTGCAACCTGGACACACCTGGATGGGGTCAGGAC

TGTGCAAGCTGCCTGTGGCCAGGCTGGGACTCGCCAGCATGCCACTGTGATAGCCACTGCTCTGGCACTCATTGCCTGGCCTACCAACATGTTGCAGTGA

TTCTGGTCACCCTGACACACACGGCTTCCCACAGACATAACAGCTCCTAGGCTTCCTCCAAACAGAAGATGCTATATGGCGGGGAGTATCTAGAGCTGTT

CTGGTAGGAACGGCTCCTTACATTGTTGTCGGCAATGGTAGGTATACCCAGGAGATCTGGGGCAGCTCTTCCTATTACTGGCAGGGCCTCGCCTCCTGAC

ACTAGGATCACCTTTCTGCAGATGGCTGTCCAGCATTTTGTGGCAGTTATATTTTACTTCCACCAGAGAACAGTACAAAGGCGCCTCTGTACTTTTCATG

AACCTGACAGATAAACCAGAACTCGTGAACAAGCACACAGTTCCTTGGGTCTAGAATGTCACTGAGTTGTTCCCCATTGGCTTCTTTGTTCCTTTGAGTA

TCCTTGCTGTGCTTTCTGTACAGTAAGCACACTGAGGACTGTCCACCCTCACCTCCTCATTCTCTCCCCCACCCTCCTCAGACATGGCTCAGGGTACCAC

TGGAAAGTGAGATAGTGTTTACAGGGTAGGAGTGGGTCACCATTGGAACCAGTGGTACCTGACAGCTGTGTTCCCATCTGAGTCGATGCCCTAGGAGCTC

CTGCAGAGAGAACCTTTGTTCTGCAGGGCTATCTGCAGCTAGCCTGCTTTCTCTTCTCATGGGAACTCAGCCACTTTATTTCATACGCACCGAGCTGGGA

ACTTCAAGCAGGTGACTACGGAGAGCCACAGTGTAACAAGCAAACGGCAGGAACTCTGAGAATTCTGCACATAGTCCACCACAGCAGGCAGCATCCAGAG

TGTGAACCATGATGTGTCTCAGCATACAGCTTTGCACATGAAATGCCGTCCCATCCCTCACCCTCCTGGAGAGAAAAGCCAGGCCCAGCCCAACACCCTC

AGCCTCAGCAGCCACAGCCCTGGGTGTGTGTCTTTCTGGCTGAGTGTCTCCTGCCATAGATCCTTACTCAGCCGGGGGCCATAGGCGCCTCTGCACTTTT

CAAGAACCTGACAGATGATTTGCACTTTACCCTTGGGCATTCTGCTCTGTAGGTCATGGTTTGTTCACAGGCTGTAGGCAACAGCACTGATCCGTTCCTC

ACGTTCTGTATGGCGTATTTATTTATTTAACCCTCCCCGGGGAAGCTTGATAGAGGTGGCTTCTATGTGGATGGCCCGTGGTGCCAGGCTCTGGGCATCT

CCGACTTCCTCCAAGAGAATCAGCCCTGTCCACATTCACGACGTTCCAGTTAGGGTAGAGGCCACGTTTGCACCTGCACAGGTTCTTCAGGCTTTGTTAG

GCACCCAGGTAAGCTCGCCAGAGTGACTGCTGCCCAGTGTGTGTCCCTGTCAGCATAGTGATTTCCACACCTGCTTTTGCCTCAATTCTGAACTTGGCTC

AGACTCCTGAGCCCTGGATGTCTAGAGCAGAGCAGGTGGCTCGCCTCGCCTCTCCCAGCTGTTAGGAATGCCCTGGGCAGCTGGCCTTTGCAGGTTCTGG

GTCGCTGCTTACAAGAGATGCCTGTCAAGAGCGTCCAGCCTCCTTTCTGTTGCAATCTCCATGTTCCTGGTAACTGTGGCCGTTCAGATCAGTTTCATGT

TTTTTCCTTTTTATAGACTTTTGTCTTTGTATGACTTTGTTAGTAGCAGAGTAAAGTTCTATAAAATATAAATGTTTAAGG
Translation
MPTNFTVVPVEARADGAGDEAAERTEEPESPESVDQTSPTPG - UNI5423 - GDGNPRENSPFINNVEVERESYFEGKNMALFE EEMDSNPMVSSL

LNKLANYTNLSQGVVEHEEDEDSRRREVK APRMGTFIGVYLPCLQNILGVILFLRLTWIVGAAGVMESFLIVAMCCTC TMLTAISMSAIATNGVVPA 

AGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEIFL TYISPSAAIFQAETADGEAAALLNNMRVYGSCALALMAVVVFVGVKYVNKLALVF

LACVVLSILAIYAGVIKTAFAPPDIP PVCLLGNRTLANRNFDTCAKMQVVSNGTVTTALWRLFCNGSSLGATCDEYFAQNNVTEIQGIPGVASGVFLD 

DNLWSTYSDKGAFVEKKGVSSVPVSEESRPGGLPYVLTDIMTYFTMLVGIYFPSVTG GIMAGSNRSGDLKDAQKSIPTGTILAIVTTSFIY YLSCIVL

FGACIEGVVLRDK KFGEALQGNLVIGMLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIARDGIIPFLQ VFGHGKANGEPTWALLLTALICETGI

LIASLDSVAPILSM MFFLMCYMFVNLACAVQTLLRTPNWRPRFKFYHW WTLSFLGMSLCLALMFICSWYYALFAMLIAGCIYKYIEYRG GAEKEWGD

GIRGLSLNAARYALLRVEHGPPHTKNWR RPQVLVMLNLDSEQCVKHPRLLSFTSQLKAGKGLTIVGSVLEGTYLDKHVEAQRAEE NIRSLMSAEKTKG

FCQLVVSSNLRDGASHLIQSAGLGGMKHNTVLMAWPEAWKEADNPFSWKNFVD - UNI9973 - DTVRDTTAAHQALLVAKNIDLFPQNQERFSDGNI

DVWWIVHDGGMLMLLPFLLRQHK VWRKCRMRIFTVAQVDDNSIQMKKDLQMFLYHLRISAEVEVVEM VENDISAFTYEKTLMMEQRSQMLKQMQLSKN

ERERE AQLIHDRNTASHTTATARTQAPPTPDKVQMTWTKEKLIAEKHRNKDTGPSGFKDLFSLKP PDQSNVRRMHTAVKLNGVVLNKSQDAQLVLLNM

PGPPKSRQGDENY YMEFLEVLTEGLNRVLLVRGGGREVITIYS
Transcript ENSMUST00000068263
Sequence
AGTCATCGCGGCGCCTGGCGTTCCGACGCCAACATGTCCCAGCGCTTCGTGGTGACCCCAGCACAAAGCGGGACAGGGGACGCGGGAACCAGGGCAGAAG

GCGGCAACCAGCGCCTGTGCTCGGATTCCGACCCCGACCCCGACCTTGACCCCAATCCCGACCCCAGCTTGGCGGCCGCTCTGAAAATACAAGAAGTAGA

TGCGCTGCCCATTCTGCGCTACTGCCGCGAGCCCAGCCGCTATG - UNI5423 - GAGATGGAAACCCCAGGGAAAACAGCCCTTTCATCAATAATGT

GGAGGTGGAAAGAGAGAGCTACTTCGAGGGGAAGAACATGGCACTTTTTGAG GAAGAGATGGACAGCAACCCCATGGTGTCATCACTGCTGAACAAGCT

GGCCAACTATACCAACCTGAGCCAGGGTGTGGTAGAGCATGAGGAAGATGAGGACAGCCGGAGGCGAGAGGTCAAG GCCCCACGCATGGGCACCTTCAT

CGGAGTCTACCTGCCGTGCCTGCAGAACATCTTGGGTGTTATCCTTTTCCTGCGTCTGACCTGGATTGTGGGGGCAGCTGGTGTTATGGAGTCCTTCCTC

ATTGTGGCCATGTGCTGCACCTGT ACAATGCTGACAGCCATCTCCATGAGCGCCATCGCTACCAACGGCGTGGTCCCAG CGGGAGGCTCGTACTACAT

GATCTCCCGTTCGCTGGGGCCTGAGTTTGGAGGTGCTGTTGGCCTCTGCTTCTACTTGGGCACGACATTTGCAGGCGCCATGTACATCCTGGGTACCATC

GAGATCTTCCTG ACCTACATCTCTCCAAGTGCGGCCATCTTCCAGGCAGAGACGGCGGATGGCGAGGCGGCCGCACTGTTGAACAACATGCGTGTGTAT

GGCAGCTGTGCCCTGGCACTCATGGCGGTGGTGGTCTTTGTTGGTGTCAAATATGTCAACAAGCTGGCACTGGTCTTCTTAGCCTGTGTTGTGCTTTCTA

TCCTGGCCATCTATGCTGGTGTCATCAAGACAGCCTTTGCCCCACCTGACATCCC GGTCTGCCTTCTAGGGAACCGCACGCTGGCAAATCGCAACTTTG

ATACCTGTGCCAAGATGCAGGTTGTCAGCAACGGTACAGTGACCACTGCACTCTGGCGCCTCTTCTGCAATGGCTCCAGCTTGGGTGCCACCTGTGATGA

GTACTTTGCACAGAACAACGTTACTGAGATACAGGGCATCCCTGGTGTGGCCAGTGGTGTCTTCCTGG ATAACCTGTGGAGCACATATTCAGACAAGGG

GGCATTTGTGGAAAAGAAAGGTGTGTCCTCAGTGCCTGTGTCCGAGGAGAGCCGGCCTGGTGGATTGCCATACGTCCTCACAGACATCATGACCTACTTC

ACCATGCTAGTTGGCATCTACTTCCCGTCTGTAACTG TCATCAGAGATCACCTTTCCAGCAAGCAGTGGTCGTATTGGCCTATCTTCTCTGATGAATCT

TTCTATAGGCAGCATCCTCTAGGTTTTCTGTCACTGTCATCCGTATCTACTCTGCAGGGATCATGGCAGGATCCAACCGCTCCGGGGACCTCAAAGACGC

CCAGAAGTCTATTCCAACAGGGACCATTCTGGCCATCGTGACTACATCTTTCATTT ATCTTTCCTGCATAGTGCTGTTTGGGGCCTGCATTGAAGGTGT

AGTCCTGCGAGATAAGTATGTTGGGGTTCTACTACATGAAATGACTATAGTTGGTATTGTCTTTCCTGAGGGAGACTTCGGCTTTGAAATTAAATGACCT

CTGGGCCTCACAGTTGTATGTGAGTTAAATGCTCT
Translation
MSQRFVVTPAQSGTGDAGTRAEGGNQRLCSDSDPDPDLDPNPDPSLAAALKIQEVDALPILRYCREPSRYG - UNI5423 - GDGNPRENSPFINNVE

VERESYFEGKNMALFE EEMDSNPMVSSLLNKLANYTNLSQGVVEHEEDEDSRRREVK APRMGTFIGVYLPCLQNILGVILFLRLTWIVGAAGVMESFL

IVAMCCTC TMLTAISMSAIATNGVVPA AGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEIFL TYISPSAAIFQAETADGEAAALLNNM

RVYGSCALALMAVVVFVGVKYVNKLALVFLACVVLSILAIYAGVIKTAFAPPDIP PVCLLGNRTLANRNFDTCAKMQVVSNGTVTTALWRLFCNGSSLG

ATCDEYFAQNNVTEIQGIPGVASGVFLD DNLWSTYSDKGAFVEKKGVSSVPVSEESRPGGLPYVLTDIMTYFTMLVGIYFPSVTV VIRDHLSSKQWSY

WPIFSDESFYRQHPLGFLSLSSVSTLQGSWQDPTAPGTSKTPRSLFQQGPFWPS 

For any suggestions or comments, please send an email to unitrap@crg.es