Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000017765 (Slc12a4)
Chromosomal location
Chr 8: 108467493 - 108489997 (-)
Description
solute carrier family 12, member 4 Gene [Source:MGI (curated);Acc:Slc12a4-001]
RefSeq_dna
NM_009195 
RefSeq_peptide
NP_033221.1 
UniGene
Mm.292447 
MGI
MGI:1309465 
Uniprot/SWISSPROT
Q9JIS8 
Uniprot/SPTREMBL
Q3TJG5 Q3TJM8 Q3TLV0 Q3TPD4 Q3TWV2 Q3TWZ6 Q3U689 Q3U9N0 Q6NXV2 Q9QY65 Q9QY75 Q3UDQ8 
Human Ortholog
ENSG00000124067 (SLC12A4)
Omim not available
UniTrap UNI9928
Vector Insertion
Chr 8: 108489818 - 108489940
Public Clones XC054 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29838
Vector Insertion
Chr 8: 108484575 - 108489940
Public Clones (sanger) D071D06 (ggtc) E051D11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000116429
Sequence
ATGCCTCACTTCACCGTGGTGCCGGTGGACGGGCCGCGACGCGGCGACTATGACAACCTCGAGGGGCTCAGTTGGGTGGACTACGGCGAGCGCGCCGAGC

GGGAAGACTCGGACG - UNI9928 - - UNI29838 - GACAGGGTAACCACAGAGAGAATAGCCCTTTCCTTTGCCCTTTGGACGCCTCCAGAGGA

AATGACTACTATGACCGGAACTTGGCACTGTTTGAG - UNI29838 - GAGGAGCTGGACATCCGCCCAAAGGTGTCATCTCTCCTGGGCAAGCTTGT

CAGCTATACCAACCTCACCCAAGGAGCCAAGGAGCACGAGGAGGCTGAGAGTGGAGAAGGTGGCCGACGGAGAGCTGCCAAG GCTCCCAGCATGGGCAC

ACTCATGGGAGTGTACCTGCCCTGCCTGCAGAATATCTTTGGGGTCATCCTCTTCCTGCGGCTGACCTGGATGGTGGGCACAGCTGGTGTGCTGCAGGCT

CTCCTCATTGTCCTCATCTGCTGCTGCTGT ACCCTGCTGACAGCCATCTCCATGAGCGCCATTGCCACCAACGGCGTGGTTCCAG CTGGTGGCTCGTA

CTTCATGATTTCCCGCTCTTTGGGACCAGAATTCGGAGGTGCTGTGGGCCTGTGCTTCTACCTGGGGACGACATTTGCAGCAGCCATGTATATCCTAGGG

GCCATTGAGATCTTGCTG ACCTACATTGCTCCGCCAGCTGCCATCTTTTACCCATCGGGCACCCATGACATGTCAAGCGCCACCTTGAATAACATGAGA

GTGTATGGGACCATTTTCCTGACTCTGATGACCCTAGTGGTGTTTGTCGGTGTCAAGTACGTGAACAAGTTTGCCTCGCTCTTCCTGGCCTGCGTGATCA

TCTCCATCCTTTCCATTTACGCGGGAGGCATCAAGTCCATTTTTGACCCTCCCGTGTTTCC GGTGTGTATGCTGGGCAATAGGACCCTGTCTCGGGACC

AGTTTGACATCTGTGCCAAGACAGTCGTGGTGGACAATGAGACAGTGGCCACCCGGCTGTGGACTTTCTTCTGCCACAGCCCCAACCTTACTGCTGACTC

CTGTGACCCCTACTTCCTGCTCAACAATGTGACAGAGATTCCTGGCATACCTGGGGCAGCTGCTGGTGTGCTCCAGG AGAACCTCTGGAGCGCTTACCT

GGAGAAGGGGGAGGTCGTGGAGAAGCATGGGCTGCCGTCCACAGACACCCTCGGCCTAAAGGAGAGCCTGTCCCTGTATGTGGTGGCTGACATCGCCACG

TCCTTCACCGTGCTGGTTGGCATCTTTTTCCCTTCTGTGACAG GCATCATGGCTGGTTCAAACCGCTCCGGGGATCTCCGTGACGCCCAGAAGTCTATC

CCAGTGGGGACCATTCTGGCCATTGTTACCACTTCGCTGGTGT ACTTCAGCAGTGTGATCCTCTTCGGTGCCTGCATCGAGGGTGTGGTACTCCGGGAC

AA GTACGGTGATGGCGTCAGCAGGAACCTGGTGGTGGGCACCCTGGCCTGGCCTTCGCCTTGGGTCATCGTGGTTGGCTCCTTCTTCTCAACATGTGGG

GCTGGTCTCCAGAGCCTCACTGGGGCGCCACGTTTACTGCAAGCCATTGCCAAGGATAACATCATCCCCTTCCTCCGG GTGTTTGGCCATGGGAAAGCA

AACGGTGAACCGACGTGGGCCCTCCTCCTGACAGCGCTCATCGCTGAGCTGGGCATCCTGATTGCTTCCCTTGACATGGTGGCCCCCATTCTGTCCAT G

TTCTTTCTGATGTGTTACCTCTTTGTAAACTTGGCCTGTGCCGTGCAGACACTTCTGAGGACCCCCAACTGGCGGCCCCGGTTCAAGTACTATCACTG G

ACATTGTCTTTCCTAGGCATGAGTCTCTGCCTGGCTCTTATGTTTGTCTCCTCCTGGTACTATGCCCTAGTGGCCATGCTCATCGCAGGCATGATCTACA

AGTACATCGAGTACCAAGG GGCCGAGAAGGAGTGGGGCGATGGGATCCGAGGCCTGTCCCTGAGTGCGGCACGCTATGCACTGCTGAGGCTGGAGGAAG

GGCCTCCTCACACCAAGAACTGGCG GCCTCAGCTCCTGGTGCTGCTTAAGTTAGACGAAGATCTTCATGTGAAGTACCCCCGGCTCCTCACCTTCGCCT

CCCAGCTGAAGGCCGGGAAGGGCCTGACAATCGTTGGCTCTGTCATCCAGGGCAGCTTTCTGGAGAGCTATGGTGAAGCCCAGGCCGCTGAGCAG ACCA

TCAAGAACATGATGGACATTGAGAAAGTCAAAGGCTTCTGCCAGGTAGTGGTGGCCAGCAAGGTTCGAGAGGGACTGGCCCACCTCATCCAGTCTTGCGG

CCTGGGCGGCATGAGACACAACTCCGTGGTGCTGGGCTGGCCCTATGGCTGGCGACAGAGTGAGGACCCACGTGCCTGGAAGACCTTTATTG ACACTGT

GCGCTGCACCACAGCTGCCCACCTGGCCCTGCTGGTGCCAAAGAACATAGCTTTCTACCCCAGCAACCACGAGCGCTACCTGGATGGCCATATCGACGTG

TGGTGGATCGTGCATGATGGAGGCATGCTTATGCTGCTGCCCTTTCTGCTGCGCCAGCATAAG GTTTGGAAGAAGTGCCGGATGCGCATTTTCACCGTG

GCCCAGATGGATGACAACAGCATCCAGATGAAGAAGGATCTGGCCATCTTCCTGTATCACCTCCGCCTGGAAGCTGAAGTGGAGGTGGTAGAGATG CAC

AACAGTGACATCTCTGCCTATACCTATGAGCGGACACTGATGATGGAGCAGCGGTCTCAGATGCTGCGGCAGATGAGGTTGACCAAAACTGAGCGGGATC

GAGAG GCCCAGCTGGTAAAGGACAGGCACTCGGCTCTTAGGCTGGAGAGCCTCTACTCCGACGAGGAGGAAGAGTCTGTGGCAGGGGCCGACAAGATCC

AGATGACGTGGACCAGAGACAAGTACATGGCTGAGCCCTGGGACCCCAGCCACGCCCCTGACAACTTCCGGGAGCTGGTGCACATTAAGCC GGACCAGT

CCAACGTGCGGCGCATGCACACTGCTGTGAAGCTCAACGAGGTCATTGTCACGCGCTCCCACGATGCCCGTCTGGTTTTGCTGAACATGCCTGGCCCCCC

TAAGAACAGCGAGGGCGACGAGAACT ACATGGAATTCCTTGAAGTCCTAACCGAGGGCCTTGAACGGGTGTTGTTGGTGCGTGGCGGCGGCCGGGAAGT

CATCACCATCTATTCCTGAGCCCCGATGGAGTCTTGTGGCCTGGAGTTGGGGTGTCTAGGACAACAGTGCCCGGCCTTGCACCTACTTGCCAGTTCTGCT

TTGCCCAGCCTTGCTTTGGACCAGCTCTGCTACGTCTCCAGGGAAACCAAGCTTGGGCCTTGCAGTGGAAATGGATCCGAGGGCCCAGGGGACCCTGGTG

GATTTAGGGACTGTCCCCTCCCATACTCCAATAGAGGCCTATCCTGACTAGAGAAGACTGGTGAGGGTTGATACGGGATTTGAATTCCCAGATGGGCCCA

CAAGTGCTATTTATTGTATATTTATTGTTTGGATGTCATCATTTCAGAAAGGGGAAGAGGGGCACAGTAAGAGGGGGAGCTGAGCTGGGCCTGCCTGCAG

GAAGACCTGGCCCAGGCTGCTGTGGGCAGAGGCCCTCATCAAGCCAAGTGGAATGGAGCCGGCCAAGCTGAGCCTGACTTTTTTCAATAAAACATTGTGT

ACTTCTGG
Translation
MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAEREDSDG - UNI9928 - - UNI29838 - GQGNHRENSPFLCPLDASRGNDYYDRNLALFE - 

UNI29838 - EELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGGRRRAAK APSMGTLMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVL

ICCCC TLLTAISMSAIATNGVVPA AGGSYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEILL TYIAPPAAIFYPSGTHDMSSATLNNMRVY

GTIFLTLMTLVVFVGVKYVNKFASLFLACVIISILSIYAGGIKSIFDPPVFP PVCMLGNRTLSRDQFDICAKTVVVDNETVATRLWTFFCHSPNLTADS

CDPYFLLNNVTEIPGIPGAAAGVLQE ENLWSAYLEKGEVVEKHGLPSTDTLGLKESLSLYVVADIATSFTVLVGIFFPSVTG GIMAGSNRSGDLRDAQ

KSIPVGTILAIVTTSLVY YFSSVILFGACIEGVVLRDK KYGDGVSRNLVVGTLAWPSPWVIVVGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLR 

VFGHGKANGEPTWALLLTALIAELGILIASLDMVAPILSM MFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHW WTLSFLGMSLCLALMFVSSWYYAL

VAMLIAGMIYKYIEYQG GAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWR RPQLLVLLKLDEDLHVKYPRLLTFASQLKAGKGLTIVGSVIQGSF

LESYGEAQAAEQ TIKNMMDIEKVKGFCQVVVASKVREGLAHLIQSCGLGGMRHNSVVLGWPYGWRQSEDPRAWKTFID DTVRCTTAAHLALLVPKNIA

FYPSNHERYLDGHIDVWWIVHDGGMLMLLPFLLRQHK VWKKCRMRIFTVAQMDDNSIQMKKDLAIFLYHLRLEAEVEVVEM HNSDISAYTYERTLMME

QRSQMLRQMRLTKTERDRE AQLVKDRHSALRLESLYSDEEEESVAGADKIQMTWTRDKYMAEPWDPSHAPDNFRELVHIKP PDQSNVRRMHTAVKLNE

VIVTRSHDARLVLLNMPGPPKNSEGDENY YMEFLEVLTEGLERVLLVRGGGREVITIYS
Transcript ENSMUST00000034370
Sequence
AGCCTGGGGCGGCGGGGACTGCCGGCTGGAGGCCGGGACCGCGGGCCAAGCGCGCGCGATGCCTCACTTCACCGTGGTGCCGGTGGACGGGCCGCGACGC

GGCGACTATGACAACCTCGAGGGGCTCAGTTGGGTGGACTACGGCGAGCGCGCCGAGCGGGAAGACTCGGACGGTGAGG - UNI9928 - - UNI298

38 - GACAGGGTAACCACAGAGAGAATAGCCCTTTCCTTTGCCCTTTGGACGCCTCCAGAGGAAATGACTACTATGACCGGAACTTGGCACTGTTTGAG

 - UNI29838 - GAGGAGCTGGACATCCGCCCAAAGGTGTCATCTCTCCTGGGCAAGCTTGTCAGCTATACCAACCTCACCCAAGGAGCCAAGGAGCA

CGAGGAGGCTGAGAGTGGAGAAGGTGGCCGACGGAGAGCTGCCAAG GCTCCCAGCATGGGCACACTCATGGGAGTGTACCTGCCCTGCCTGCAGAATAT

CTTTGGGGTCATCCTCTTCCTGCGGCTGACCTGGATGGTGGGCACAGCTGGTGTGCTGCAGGCTCTCCTCATTGTCCTCATCTGCTGCTGCTGT ACCCT

GCTGACAGCCATCTCCATGAGCGCCATTGCCACCAACGGCGTGGTTCCAG CTGGTGGCTCGTACTTCATGATTTCCCGCTCTTTGGGACCAGAATTCGG

AGGTGCTGTGGGCCTGTGCTTCTACCTGGGGACGACATTTGCAGCAGCCATGTATATCCTAGGGGCCATTGAGATCTTGCTG ACCTACATTGCTCCGCC

AGCTGCCATCTTTTACCCATCGGGCACCCATGACATGTCAAGCGCCACCTTGAATAACATGAGAGTGTATGGGACCATTTTCCTGACTCTGATGACCCTA

GTGGTGTTTGTCGGTGTCAAGTACGTGAACAAGTTTGCCTCGCTCTTCCTGGCCTGCGTGATCATCTCCATCCTTTCCATTTACGCGGGAGGCATCAAGT

CCATTTTTGACCCTCCCGTGTTTCC GGTGTGTATGCTGGGCAATAGGACCCTGTCTCGGGACCAGTTTGACATCTGTGCCAAGACAGTCGTGGTGGACA

ATGAGACAGTGGCCACCCGGCTGTGGACTTTCTTCTGCCACAGCCCCAACCTTACTGCTGACTCCTGTGACCCCTACTTCCTGCTCAACAATGTGACAGA

GATTCCTGGCATACCTGGGGCAGCTGCTGGTGTGCTCCAGG AGAACCTCTGGAGCGCTTACCTGGAGAAGGGGGAGGTCGTGGAGAAGCATGGGCTGCC

GTCCACAGACACCCTCGGCCTAAAGGAGAGCCTGTCCCTGTATGTGGTGGCTGACATCGCCACGTCCTTCACCGTGCTGGTTGGCATCTTTTTCCCTTCT

GTGACAG GCATCATGGCTGGTTCAAACCGCTCCGGGGATCTCCGTGACGCCCAGAAGTCTATCCCAGTGGGGACCATTCTGGCCATTGTTACCACTTCG

CTGGTGT ACTTCAGCAGTGTGATCCTCTTCGGTGCCTGCATCGAGGGTGTGGTACTCCGGGACAA GTACGGTGATGGCGTCAGCAGGAACCTGGTGGT

GGGCACCCTGGCCTGGCCTTCGCCTTGGGTCATCGTGGTTGGCTCCTTCTTCTCAACATGTGGGGCTGGTCTCCAGAGCCTCACTGGGGCGCCACGTTTA

CTGCAAGCCATTGCCAAGGATAACATCATCCCCTTCCTCCGG GTGTTTGGCCATGGGAAAGCAAACGGTGAACCGACGTGGGCCCTCCTCCTGACAGCG

CTCATCGCTGAGCTGGGCATCCTGATTGCTTCCCTTGACATGGTGGCCCCCATTCTGTCCAT GTTCTTTCTGATGTGTTACCTCTTTGTAAACTTGGCC

TGTGCCGTGCAGACACTTCTGAGGACCCCCAACTGGCGGCCCCGGTTCAAGTACTATCACTG GACATTGTCTTTCCTAGGCATGAGTCTCTGCCTGGCT

CTTATGTTTGTCTCCTCCTGGTACTATGCCCTAGTGGCCATGCTCATCGCAGGCATGATCTACAAGTACATCGAGTACCAAGG GGCCGAGAAGGAGTGG

GGCGATGGGATCCGAGGCCTGTCCCTGAGTGCGGCACGCTATGCACTGCTGAGGCTGGAGGAAGGGCCTCCTCACACCAAGAACTGGCG GCCTCAGCTC

CTGGTGCTGCTTAAGTTAGACGAAGATCTTCATGTGAAGTACCCCCGGCTCCTCACCTTCGCCTCCCAGCTGAAGGCCGGGAAGGGCCTGACAATCGTTG

GCTCTGTCATCCAGGGCAGCTTTCTGGAGAGCTATGGTGAAGCCCAGGCCGCTGAGCAG ACCATCAAGAACATGATGGACATTGAGAAAGTCAAAGGCT

TCTGCCAGGTAGTGGTGGCCAGCAAGGTTCGAGAGGGACTGGCCCACCTCATCCAGTCTTGCGGCCTGGGCGGCATGAGACACAACTCCGTGGTGCTGGG

CTGGCCCTATGGCTGGCGACAGAGTGAGGACCCACGTGCCTGGAAGACCTTTATTG ACACTGTGCGCTGCACCACAGCTGCCCACCTGGCCCTGCTGGT

GCCAAAGAACATAGCTTTCTACCCCAGCAACCACGAGCGCTACCTGGATGGCCATATCGACGTGTGGTGGATCGTGCATGATGGAGGCATGCTTATGCTG

CTGCCCTTTCTGCTGCGCCAGCATAAG GTTTGGAAGAAGTGCCGGATGCGCATTTTCACCGTGGCCCAGATGGATGACAACAGCATCCAGATGAAGAAG

GATCTGGCCATCTTCCTGTATCACCTCCGCCTGGAAGCTGAAGTGGAGGTGGTAGAGATG CACAACAGTGACATCTCTGCCTATACCTATGAGCGGACA

CTGATGATGGAGCAGCGGTCTCAGATGCTGCGGCAGATGAGGTTGACCAAAACTGAGCGGGATCGAGAG GCCCAGCTGGTAAAGGACAGGCACTCGGCT

CTTAGGCTGGAGAGCCTCTACTCCGACGAGGAGGAAGAGTCTGTGGCAGGGGCCGACAAGATCCAGATGACGTGGACCAGAGACAAGTACATGGCTGAGC

CCTGGGACCCCAGCCACGCCCCTGACAACTTCCGGGAGCTGGTGCACATTAAGCC GGACCAGTCCAACGTGCGGCGCATGCACACTGCTGTGAAGCTCA

ACGAGGTCATTGTCACGCGCTCCCACGATGCCCGTCTGGTTTTGCTGAACATGCCTGGCCCCCCTAAGAACAGCGAGGGCGACGAGAACT ACATGGAAT

TCCTTGAAGTCCTAACCGAGGGCCTTGAACGGGTGTTGTTGGTGCGTGGCGGCGGCCGGGAAGTCATCACCATCTATTCCTGAGCCCCGATGGAGTCTTG

TGGCCTGGAGTTGGGGTGTCTAGGACAACAGTGCCCGGCCTTGCACCTACTTGCCAGTTCTGCTTTGCCCAGCCTTGCTTTGGACCAGCTCTGCTACGTC

TCCAGGGAAACCAAGCTTGGGCCTTGCAGTGGAAATGGATCCGAGGGCCCAGGGGACCCTGGTGGATTTAGGGACTGTCCCCTCCCATACTCCAATAGAG

GCCTATCCTGACTAGAGAAGACTGGTGAGGGTTGATACGGGATTTGAATTCCCAGATGGGCCCACAAGTGCTATTTATTGTATATTTATTGTTTGGATGT

CATCATTTCAGAAAGGGGAAGAGGGGCACAGTAAGAGGGGGAGCTGAGCTGGGCCTGCCTGCAGGAAGACCTGGCCCAGGCTGCTGTGGGCAGAGGCCCT

CATCAAGCCAAGTGGAATGGAGCCGGCCAAGCTGAGCCTGACTTTTTTCAATAAAACATTGTGTACTTCTGG
Translation
MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAEREDSDGEG - UNI9928 - - UNI29838 - GQGNHRENSPFLCPLDASRGNDYYDRNLALFE 

- UNI29838 - EELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGGRRRAAK APSMGTLMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLI

VLICCCC TLLTAISMSAIATNGVVPA AGGSYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEILL TYIAPPAAIFYPSGTHDMSSATLNNMR

VYGTIFLTLMTLVVFVGVKYVNKFASLFLACVIISILSIYAGGIKSIFDPPVFP PVCMLGNRTLSRDQFDICAKTVVVDNETVATRLWTFFCHSPNLTA

DSCDPYFLLNNVTEIPGIPGAAAGVLQE ENLWSAYLEKGEVVEKHGLPSTDTLGLKESLSLYVVADIATSFTVLVGIFFPSVTG GIMAGSNRSGDLRD

AQKSIPVGTILAIVTTSLVY YFSSVILFGACIEGVVLRDK KYGDGVSRNLVVGTLAWPSPWVIVVGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFL

R VFGHGKANGEPTWALLLTALIAELGILIASLDMVAPILSM MFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHW WTLSFLGMSLCLALMFVSSWYY

ALVAMLIAGMIYKYIEYQG GAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWR RPQLLVLLKLDEDLHVKYPRLLTFASQLKAGKGLTIVGSVIQG

SFLESYGEAQAAEQ TIKNMMDIEKVKGFCQVVVASKVREGLAHLIQSCGLGGMRHNSVVLGWPYGWRQSEDPRAWKTFID DTVRCTTAAHLALLVPKN

IAFYPSNHERYLDGHIDVWWIVHDGGMLMLLPFLLRQHK VWKKCRMRIFTVAQMDDNSIQMKKDLAIFLYHLRLEAEVEVVEM HNSDISAYTYERTLM

MEQRSQMLRQMRLTKTERDRE AQLVKDRHSALRLESLYSDEEEESVAGADKIQMTWTRDKYMAEPWDPSHAPDNFRELVHIKP PDQSNVRRMHTAVKL

NEVIVTRSHDARLVLLNMPGPPKNSEGDENY YMEFLEVLTEGLERVLLVRGGGREVITIYS

For any suggestions or comments, please send an email to unitrap@crg.es