Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000017774 (Myo1c)
Chromosomal location
Chr 11: 75464192 - 75488134 (+)
Description
myosin IC Gene [Source:MGI (curated);Acc:Myo1c-002]
RefSeq_dna
NM_001080775 NM_008659 NM_001080774 
RefSeq_peptide
NP_001074243.1 NP_032685.1 NP_001074244.1 
UniGene
Mm.413478 Mm.234502 
MGI
MGI:106612 
Uniprot/SWISSPROT
Q9WTI7 
Uniprot/SPTREMBL
Q3U231 Q5ND46 Q5ND49 Q3TBQ4 Q9ERB6 Q5ND45 
Human Ortholog
ENSG00000197879 (MYO1C)
Omim not available
UniTrap UNI29611
Vector Insertion
Chr 11: 75465168 - 75465651
Public Clones E139A07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33700
Vector Insertion
Chr 11: 75465846 - 75469516
Public Clones (sanger) IST14169F12 (tigm) IST14341D2 (tigm) IST12139C8 (tigm) IST14467G11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22071
Vector Insertion
Chr 11: 75469894 - 75470993
Public Clones not available
Private Clones OST309492 (lexicon) OST238884 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37427
Vector Insertion
Chr 11: 75485225 - 75485306
Public Clones PST22687-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000102505
Sequence
ATGGCACTCCAAGTAGAACTGATACCAACGGGAGAGATCATCCGTGTGGTCCATCCCCACAGGCCATGCAAACTC - UNI22071 - - UNI29611 

- - UNI33700 - GCCCTGGGCAGTGACGGGGTTCGAGTGACCATGGAGAGCGCCTTGACTGCCCGAGACCGGGTAGGGGTGCAGGACTTTGTCCTGC

TGGAGAATTTCACCAGTGAGGCTGCCTTCATTGAGAACCTCCGGCGGCGGTTCCGGGAGAACCTCATTTAT ACCTACATCGGTCCTGTCCTAGTCTCTG

TCAATCCCTACCGAGACCTACAGATCTACAGCCGGCAGCATATGGAACGCTACCGTGGTGTCAGTTTCTATGAAGTACCACCTCATTT GTTTGCAGTGG

CTGACACTGTATACCGGGCACTTCGTACTGAGCGTCGGGACCAGGCAGTGATGATTTCTGGAGAGAGTGGGGCAGGCAAGACAGAGGCCACCAAGAGACT

GCTCCAGTTCTATGCAGAGACCTGCCCAGCCCCTGAACGGGGTGGCGCAGTGCGAGACCGCCTGTTGCAGAGCAACCCCGTGTTAGAG GCCTTTGGGAA

TGCCAAGACTCTCCGCAACGATAACTCCAGCCGGTTTGGAAAGTACATGGATGTGCAGTTTGACTTCAAG GGTGCCCCCGTGGGAGGCCACATTCTCAG

TTACCTCCTGGAAAAGTCCCGGGTGGTGCACCAAAATCACGGAGAGCGGAACTTCCACGTCTTTTACCAGCTACTGGAGGGGGGCGAGGAGGAGACTCTC

CGTCGGCTGGGCTTGGAACGGAACCCCCAGAGCTACTTGTACCTGGTGAAG GGCCAGTGTGCCAAGGTCTCCTCCATCAACGACAAGAGTGACTGGAAG

GTTATGAGGAAGGCGCTGTCCGTCATTGACTTCACTGAGGATGAAGTGGAG GACTTGCTCAGCATCGTGGCCAGCGTCCTACATCTGGGCAACATCCAC

TTTGCTGCTGACGAGGACAGCAATGCCCAGGTTACTACTGAGAACCAGCTCAAATATCTGACCAGG CTCCTTGGTGTGGAAGGTACAACACTTAGGGAA

GCCCTGACCCACAGGAAGATCATCGCCAAGGGGGAAGAG CTCCTGAGCCCACTGAACCTTGAACAGGCGGCATATGCAAGGGATGCGCTTGCCAAGGCT

GTGTACAGCCGGACATTCACCTGGCTGGTCAGAAAGATCAATAGGTCACTGGCCTCTAAG GACGCTGAGAGCCCCAGCTGGCGAAGCACCACGGTTCTT

GGGCTCCTGGACATTTACGGCTTTGAAGTGTTTCAGCATAACAG CTTCGAGCAGTTCTGCATCAACTACTGCAATGAGAAGCTGCAGCAGCTCTTCATC

GAGCTGACTCTCAAGTCGGAGCAGGAGGAATACGAGGCTGAGGGCATCGCG TGGGAACCTGTCCAGTACTTCAACAACAAGATCATCTGTGACCTGGTA

GAGGAGAAGTTCAAGGGCATCATCTCCATCTTG GATGAAGAGTGCCTGCGTCCTGGGGAGGCCACGGACCTGACCTTTCTGGAGAAGTTGGAGGACACT

GTCAAGCCCCACCCTCACTTCCTGAC GCACAAGCTCGCTGACCAGAAGACCAGGAAATCTCTAGACCGAGGGGAGTTCCGCCTTCTGCATTATGCTGGA

GAGGTGACCTACAGTGTGACTG GGTTTCTGGATAAAAACAATGACCTCCTCTTCCGGAACCTGAAGGAG ACCATGTGCAGCTCAATGAACCCCATCAT

GGCCCAGTGCTTTGACAAGAGTGAGCTCAGTGACAAGAAGCGGCCAGAGACG GTGGCCACCCAGTTCAAGATGAGCCTCCTGCAGCTCGTGGAGATCCT

GAGGTCTAAGGAGCCTGCCTATATCCGGTGCATCAAGCCAAACGACGCCAAGCAGCCGG GTCGCTTTGATGAGGTGCTCATCCGACATCAGGTGAAGTA

CCTGGGACTGATGGAGAATCTGCGCGTGCGCAGAGCTGGCTTTGCCTATCGTCGCAAATATGAGGCTTTCCTGCAGAG GTACAAGTCACTGTGCCCAGA

GACATGGCCCATGTGGGCAGGACGGCCCCAGGATGGTGTGGCCGTGTTGGTCAGACACCTCGGCTACAAGCCAGAAGAGTACAAAATGGGCAG GACTAA

GATCTTCATCCGATTTCCCAAGACCTTGTTTGCCACAGAGGACTCCCTGGAAGTCCGGCGGCAGAGTCTAG CCACCAAGATCCAGGCGGCCTGGAGGGG

CTTTCATTGGCGACAGAAATTTCTCCGGGTGAAGCGATCAG CCATCTGTATCCAGTCATGGTGGCGTGGCACACTGGGCCGGAGGAAGGCAGCCAAGAG

GAAGTGGGCAGCCCAGACCATCCGTCG ACTCATCCGTGGCTTCATTTTGCGCCATTCACCCCGGTGCCCTGAGAATGCCTTCTTCTTGGACCACGTGCG

CGCCTCATTTTTGCTTAACCTGAGGCGGCAACTGCCCCGGAATGTTCTGGACACCTCCTGGCCCACACCCCCACCTGCCCTGAGAGAG GCCTCAGAACT

GCTACGGGAACTGTGCATGAAGAACATGGTGTGGAAGTACTGCCGGAGCATCAGCCCTGAGTGGAAGCAGCAG CTGCAGCAAAAGGCGGTGGCTAGTGA

AATTTTCAAGGGCAAGAAGGACAACTACCCCCAGAGTGTCCCCAGACTCTTCATTAGCACACGGCTTG GCACAGAGGAGATCAGCCCCAGAGTGCTTCA

ATCCTTGGGCTCTGAACCCATCCAG TATGCCGTGCCCGTGGTAAAATACGACCGTAAGGGTTACAAGCCTCGCCCCCGGCAGCTGCTGCTCACGCCCAG

TGCTGTGGTCATTGTGGAGGATGCTAAAGTCAAGCAGAGAATTGATTATGCCAACCTAACCG GAATCTCTGTCAGTAGCCTGAGTGATAGCCTATTTGT

GCTTCACGTGCAGCGTGAAGACAACAAGCAGAAG GGAGATGTGGTGCTGCAGAGTGATCATGTGATCGAGACACTAACCAAGACGGCCCTCAGTGCTGA

CCGCGTGAACAATATCAACATCAACCAGGGCAG CATAACGTTTGCAGGGGGTCCAGGCAGGGACGGCATCATTGACTTCACATCGGGCTCAGAGCTTCT

CATCACCAAGGCTAAGAATGGCCACCTGGCTGTG GTGGCCCCACGGCTGAATTCTCGGTGATGAAGGCTTCAGTGGACCCCTCCTGACTCCTGATGCTT

CGCTTAGTCCCCTCCTCCCCTCCCAGTTACCAAAGACTCAAGCTTCCAGACAGGGATCCATGGACACCCTCAAAACCCACCTGCAAACTCCTGCCTCCTG

CTCGCCCCCTCTCGAGGTGATCAGGAGCCAGGGAGCTACCCCATGAGTGGGCCAGGCCGGGCCACAGCAATAGAAAAGCAGAGGCCTGAGCAGGCCAGGC

CAGCCCTCTGCTGATGCCAAATATCTAAGAGAAGGGAATTTTAACTGAGGTTTTCTCTGAGATTTTTTGATGCTTTATAGGAAACTATTTTTTTAAGAAA

GCCATTTTCCTACCCTAAACACACTGGATGTGTTTTTCCCTGCCTCGAACAGGGCAAGGAATGTAACTGAAAGACTGACTGGGCTGGGCTGGAAGGTCCT

CTTCTCTGGCCAAGCCTCTCCTCATTCCCTTGTCTGTCTGTCCATCCACCTGCACCTTTTGCAGCCCACTATGACCTCCACCAAAAGGCTGAGGCCACCT

CTGCCTACCCCATATTCCTGCCTTAAGAATGTCCTTTTAGGGGCTGGGGTATAGCCCAGTGGTAGAACTGGTGCTAAGCATGTGTGAGACCCTGGGCTCA

ATCCCCAGCATTAAAAAATAAAAAATAGGTTTTTAATATTTTCACCCCAGTCTGAGGGCATCCCTAAAGTGGGGGAAAAGTCTTAAGAGTTTGGAAGTCT

TCAGAGACAGTGTCTGGTCCAGGCTCCTGGAATCTACAGAGCTGGAGACAGAGGCACACAGAGGGAGGGAAGACTTGCCTAGTAGAAGACTGAAGCAAAT

CCTAAAGTGAAGCCCGCCCTCAGCACATCTCACTGCCTTTCCCAGGGACAGGGAGGCCCATAAGGCAAGGGTCGCGTCTCATGTATGCACCTGGCTCTCT

GACCAGCAATCACCCTTGGGAGCTACCGGGTGGGAGGGACTCTTCTGCCTGGGTCTATGCCTTAGGATGACAACCTCCATACACATACATACTTTCGACC

CAATTTAAGAATGGTAGGGTCTTTTATTGGCCTTGGGTGCCTCTGTGACCTGGGAGCCTAGGGACAGGGCTGGCCTTGGAGGAACTGCAGGGGCATCACC

TCTTTCTGCTGCTTCTCTCCACCCCAGAGGTCCTTGGGTTTGCCCAGCTCCCTCTGTGCCCTCTGGGGCTCTCAGCCCACTGCTGACACTTCTGCAATCC

AGAGAAACACTAAATAAAGCAATATGTATTTGCCAACACAGTCTTCCTGTGAGTGTGGAAAAGGGGCCCTAGAAGGTAGACATTCTTAAGGGGCTTGGCA

CTACAGAAGAAAGGAGACAGACCTACTTAGGAGCAATAGAGAGAAACCAAGTTAGGTGTGGTATTGTGAGCCTTAGTGCTCAGGAAGCAGGGACAGGAGG

ATTGGATTTCTTAGTTCTAGGCCAGCCTGGTCTACAAATCAAGTTCCAGGGCTATATAGACAGGCACGGGGCTTTGGATTTGGGCAAATAAATACCTGGT

CTGGCAGCACCGCTGGACTAAGGAGACCTAGCATGGGCAATATAAGCCCAGGGGCCTGTGCTGATGCAAGACTCAGGTGGGGAGGGTCAGCACTTCATAA

GGAAGCTGGTGTTTGAGGTATCTCAGGGGCTTGCTTCCAGTTCTGGGGATAAAGAATCCAGTCCAAAGTGGCTGGAGCGGTAAAGGCCACTTGTCAACAA

TGGCCATTTTATTGTCCTGGGGAGATCTACTTCTAGGTGATCAAAAGACATTGTTAGGAAAATGTCTTGGGGGCTAGAGAGATGGCTCAGTGGTTAAGAG

AACTGACTGCTCTTCTGAAGGTCCTGAGTTCAATTCCCAGCAACTACACGGTGGCTCACAACCATCTGTAATGGGGTCTGATGCCTTCTGGTGTGTCTAA

AGGGAGCAATGGTGATGTACTCATATGCATAAAATAAATGAATAAATAAACAAATCTT
Translation
MALQVELIPTGEIIRVVHPHRPCKL - UNI22071 - - UNI29611 - - UNI33700 - ALGSDGVRVTMESALTARDRVGVQDFVLLENFTSE

AAFIENLRRRFRENLIY TYIGPVLVSVNPYRDLQIYSRQHMERYRGVSFYEVPPHL LFAVADTVYRALRTERRDQAVMISGESGAGKTEATKRLLQFY

AETCPAPERGGAVRDRLLQSNPVLE AFGNAKTLRNDNSSRFGKYMDVQFDFK GAPVGGHILSYLLEKSRVVHQNHGERNFHVFYQLLEGGEEETLRRL

GLERNPQSYLYLVK GQCAKVSSINDKSDWKVMRKALSVIDFTEDEVE DLLSIVASVLHLGNIHFAADEDSNAQVTTENQLKYLTR LLGVEGTTLREA

LTHRKIIAKGEE LLSPLNLEQAAYARDALAKAVYSRTFTWLVRKINRSLASK DAESPSWRSTTVLGLLDIYGFEVFQHNS SFEQFCINYCNEKLQQL

FIELTLKSEQEEYEAEGIA WEPVQYFNNKIICDLVEEKFKGIISIL DEECLRPGEATDLTFLEKLEDTVKPHPHFLT THKLADQKTRKSLDRGEFRL

LHYAGEVTYSVTG GFLDKNNDLLFRNLKE TMCSSMNPIMAQCFDKSELSDKKRPET VATQFKMSLLQLVEILRSKEPAYIRCIKPNDAKQPG GRFD

EVLIRHQVKYLGLMENLRVRRAGFAYRRKYEAFLQR RYKSLCPETWPMWAGRPQDGVAVLVRHLGYKPEEYKMGR RTKIFIRFPKTLFATEDSLEVRR

QSLA ATKIQAAWRGFHWRQKFLRVKRSA AICIQSWWRGTLGRRKAAKRKWAAQTIRR RLIRGFILRHSPRCPENAFFLDHVRASFLLNLRRQLPRNV

LDTSWPTPPPALRE ASELLRELCMKNMVWKYCRSISPEWKQQ LQQKAVASEIFKGKKDNYPQSVPRLFISTRLG GTEEISPRVLQSLGSEPIQ YAV

PVVKYDRKGYKPRPRQLLLTPSAVVIVEDAKVKQRIDYANLTG GISVSSLSDSLFVLHVQREDNKQK GDVVLQSDHVIETLTKTALSADRVNNININQ

GS SITFAGGPGRDGIIDFTSGSELLITKAKNGHLAV VAPRLNSR
Transcript ENSMUST00000108431
Sequence
CCGGCCAGGCCGGCTGCAGTGGGTCCTAGGGTCGGGACTCCGAGCCCCCTGAGCCAAGGGGCCTGCAAGGGGCGGTGCAGGGGGCGGGCTGGCCCCTCCC

TCGGTTACGCCGCGGCCGAGTACAGACCAAGAGGCGCGGGCAGCGGAGCGGGGCGCCGGGTCCGGCAGGATGCGCTACCGGGCATCG - UNI22071 -

 GCCCTGGGCAGTGACGGGGTTCGAGTGACCATGGAGAGCGCCTTGACTGCCCGAGACCGGGTAGGGGTGCAGGACTTTGTCCTGCTGGAGAATTTCACC

AGTGAGGCTGCCTTCATTGAGAACCTCCGGCGGCGGTTCCGGGAGAACCTCATTTAT ACCTACATCGGTCCTGTCCTAGTCTCTGTCAATCCCTACCGA

GACCTACAGATCTACAGCCGGCAGCATATGGAACGCTACCGTGGTGTCAGTTTCTATGAAGTACCACCTCATTT GTTTGCAGTGGCTGACACTGTATAC

CGGGCACTTCGTACTGAGCGTCGGGACCAGGCAGTGATGATTTCTGGAGAGAGTGGGGCAGGCAAGACAGAGGCCACCAAGAGACTGCTCCAGTTCTATG

CAGAGACCTGCCCAGCCCCTGAACGGGGTGGCGCAGTGCGAGACCGCCTGTTGCAGAGCAACCCCGTGTTAGAG GCCTTTGGGAATGCCAAGACTCTCC

GCAACGATAACTCCAGCCGGTTTGGAAAGTACATGGATGTGCAGTTTGACTTCAAG GGTGCCCCCGTGGGAGGCCACATTCTCAGTTACCTCCTGGAAA

AGTCCCGGGTGGTGCACCAAAATCACGGAGAGCGGAACTTCCACGTCTTTTACCAGCTACTGGAGGGGGGCGAGGAGGAGACTCTCCGTCGGCTGGGCTT

GGAACGGAACCCCCAGAGCTACTTGTACCTGGTGAAG GGCCAGTGTGCCAAGGTCTCCTCCATCAACGACAAGAGTGACTGGAAGGTTATGAGGAAGGC

GCTGTCCGTCATTGACTTCACTGAGGATGAAGTGGAG GACTTGCTCAGCATCGTGGCCAGCGTCCTACATCTGGGCAACATCCACTTTGCTGCTGACGA

GGACAGCAATGCCCAGGTTACTACTGAGAACCAGCTCAAATATCTGACCAGG CTCCTTGGTGTGGAAGGTACAACACTTAGGGAAGCCCTGACCCACAG

GAAGATCATCGCCAAGGGGGAAGAG CTCCTGAGCCCACTGAACCTTGAACAGGCGGCATATGCAAGGGATGCGCTTGCCAAGGCTGTGTACAGCCGGAC

ATTCACCTGGCTGGTCAGAAAGATCAATAGGTCACTGGCCTCTAAG GACGCTGAGAGCCCCAGCTGGCGAAGCACCACGGTTCTTGGGCTCCTGGACAT

TTACGGCTTTGAAGTGTTTCAGCATAACAG CTTCGAGCAGTTCTGCATCAACTACTGCAATGAGAAGCTGCAGCAGCTCTTCATCGAGCTGACTCTCAA

GTCGGAGCAGGAGGAATACGAGGCTGAGGGCATCGCG TGGGAACCTGTCCAGTACTTCAACAACAAGATCATCTGTGACCTGGTAGAGGAGAAGTTCAA

GGGCATCATCTCCATCTTG GATGAAGAGTGCCTGCGTCCTGGGGAGGCCACGGACCTGACCTTTCTGGAGAAGTTGGAGGACACTGTCAAGCCCCACCC

TCACTTCCTGAC GCACAAGCTCGCTGACCAGAAGACCAGGAAATCTCTAGACCGAGGGGAGTTCCGCCTTCTGCATTATGCTGGAGAGGTGACCTACAG

TGTGACTG GGTTTCTGGATAAAAACAATGACCTCCTCTTCCGGAACCTGAAGGAG ACCATGTGCAGCTCAATGAACCCCATCATGGCCCAGTGCTTTG

ACAAGAGTGAGCTCAGTGACAAGAAGCGGCCAGAGACG GTGGCCACCCAGTTCAAGATGAGCCTCCTGCAGCTCGTGGAGATCCTGAGGTCTAAGGAGC

CTGCCTATATCCGGTGCATCAAGCCAAACGACGCCAAGCAGCCGG GTCGCTTTGATGAGGTGCTCATCCGACATCAGGTGAAGTACCTGGGACTGATGG

AGAATCTGCGCGTGCGCAGAGCTGGCTTTGCCTATCGTCGCAAATATGAGGCTTTCCTGCAGAG GTACAAGTCACTGTGCCCAGAGACATGGCCCATGT

GGGCAGGACGGCCCCAGGATGGTGTGGCCGTGTTGGTCAGACACCTCGGCTACAAGCCAGAAGAGTACAAAATGGGCAG GACTAAGATCTTCATCCGAT

TTCCCAAGACCTTGTTTGCCACAGAGGACTCCCTGGAAGTCCGGCGGCAGAGTCTAG CCACCAAGATCCAGGCGGCCTGGAGGGGCTTTCATTGGCGAC

AGAAATTTCTCCGGGTGAAGCGATCAG CCATCTGTATCCAGTCATGGTGGCGTGGCACACTGGGCCGGAGGAAGGCAGCCAAGAGGAAGTGGGCAGCCC

AGACCATCCGTCG ACTCATCCGTGGCTTCATTTTGCGCCATTCACCCCGGTGCCCTGAGAATGCCTTCTTCTTGGACCACGTGCGCGCCTCATTTTTGC

TTAACCTGAGGCGGCAACTGCCCCGGAATGTTCTGGACACCTCCTGGCCCACACCCCCACCTGCCCTGAGAGAG GCCTCAGAACTGCTACGGGAACTGT

GCATGAAGAACATGGTGTGGAAGTACTGCCGGAGCATCAGCCCTGAGTGGAAGCAGCAG CTGCAGCAAAAGGCGGTGGCTAGTGAAATTTTCAAGGGCA

AGAAGGACAACTACCCCCAGAGTGTCCCCAGACTCTTCATTAGCACACGGCTTG GCACAGAGGAGATCAGCCCCAGAGTGCTTCAATCCTTGGGCTCTG

AACCCATCCAG TATGCCGTGCCCGTGGTAAAATACGACCGTAAGGGTTACAAGCCTCGCCCCCGGCAGCTGCTGCTCACGCCCAGTGCTGTGGTCATTG

TGGAGGATGCTAAAGTCAAGCAGAGAATTGATTATGCCAACCTAACCG GAATCTCTGTCAGTAGCCTGAGTGATAGCCTATTTGTGCTTCACGTGCAGC

GTGAAGACAACAAGCAGAAG GGAGATGTGGTGCTGCAGAGTGATCATGTGATCGAGACACTAACCAAGACGGCCCTCAGTGCTGACCGCGTGAACAATA

TCAACATCAACCAGGGCAG CATAACGTTTGCAGGGGGTCCAGGCAGGGACGGCATCATTGACTTCACATCGGGCTCAGAGCTTCTCATCACCAAGGCTA

AGAATGGCCACCTGGCTGTG GTGGCCCCACGGCTGAATTCTCGGTGATGAAGGCTTCAGTGGACCCCTCCTGACTCCTGATGCTTCGCTTAGTCCCCTC

CTCCCCTCCCAGTTACCAAAGACTCAAGCTTCCAGACAGGGATCCATGGACACCCTCAAAACCCACCTGCAAACTCCTGCCTCCTGCTCGCCCCCTCTCG

AGGTGATCAGGAGCCAGGGAGCTACCCCATGAGTGGGCCAGGCCGGGCCACAGCAATAGAAAAGCAGAGGCCTGAGCAGGCCAGGCCAGCCCTCTGCTGA

TGCCAAATATCTAAGAGAAGGGAATTTTAACTGAGGTTTTCTCTGAGATTTTTTGATGCTTTATAGGAAACTATTTTTTTAAGAAAGCCATTTTCCTACC

CTAAACACACTGGATGTGTTTTTCCCTGCCTCGAACAGGGCAAGGAATGTAACTGAAAGACTGACTGGGCTGGGCTGGAAGGTCCTCTTCTCTGGCCAAG

CCTCTCCTCATTCCCTTGTCTGTCTGTCCATCCACCTGCACCTTTTGCAGCCCACTATGACCTCCACCAAAAGGCTGAGGCCACCTCTGCCTACCCCATA

TTCCTGCCTTAAGAATGTCCTTTTAGGGGCTGGGGTATAGCCCAGTGGTAGAACTGGTGCTAAGCATGTGTGAGACCCTGGGCTCAATCCCCAGCATTAA

AAAATAAAAAATAGGTTTTTAATATTTTCACCCCAGTCTGAGGGCATCCCTAAAGTGGGGGAAAAGTCTTAAGAGTTTGGAAGTCTTCAGAGACAGTGTC

TGGTCCAGGCTCCTGGAATCTACAGAGCTGGAGACAGAGGCACACAGAGGGAGGGAAGACTTGCCTAGTAGAAGACTGAAGCAAATCCTAAAGTGAAGCC

CGCCCTCAGCACATCTCACTGCCTTTCCCAGGGACAGGGAGGCCCATAAGGCAAGGGTCGCGTCTCATGTATGCACCTGGCTCTCTGACCAGCAATCACC

CTTGGGAGCTACCGGGTGGGAGGGACTCTTCTGCCTGGGTCTATGCCTTAGGATGACAACCTCCATACACATACATACTTTCGACCCAATTTAAGAATGG

TAGGGTCTTTTATTGGCCTTGGGTGCCTCTGTGACCTGGGAGCCTAGGGACAGGGCTGGCCTTGGAGGAACTGCAGGGGCATCACCTCTTTCTGCTGCTT

CTCTCCACCCCAGAGGTCCTTGGGTTTGCCCAGCTCCCTCTGTGCCCTCTGGGGCTCTCAGCCCACTGCTGACACTTCTGCAATCCAGAGAAACACTAAA

TAAAGCAATATGTATTTGCCAACACAGTCTTCCTGTGAGTGTGGAAAAGGGGCCCTAGAAGGTAGACATTCTTAAGGGGCTTGGCACTACAGAAGAAAGG

AGACAGACCTACTTAGGAGCAATAGAGAGAAACCAAGTTAGGTGTGGTATTGTGAGCCTTAGTGCTCAGGAAGCAGGGACAGGAGGATTGGATTTCTTAG

TTCTAGGCCAGCCTGGTCTACAAATCAAGTTCCAGGGCTATATAGACAGGCACGGGGCTTTGGATTTGGGCAAATAAATACCTGGTCTGGCAGCACCGCT

GGACTAAGGAGACCTAGCATGGGCAATATAAGCCCAGGGGCCTGTGCTGATGCAAGACTCAGGTGGGGAGGGTCAGCACTTCATAAGGAAGCTGGTGTTT

GAGGTATCTCAGGGGCTTGCTTCCAGTTCTGGGGATAAAGAATCCAGTCCAAAGTGGCTGGAGCGGTAAAGGCCACTTGTCAACAATGGCCATTTTATTG

TCCTGGGGAGATCTACTTCTAGGTGATCAAAAGACATTGTTAGGAAAATGTCTTGGGGGCTAGAGAGATGGCTCAGTGGTTAAGAGAACTGACTGCTCTT

CTGAAGGTCCTGAGTTCAATTCCCAGCAACTACACGGTGGCTCACAACCATCTGTAATGGGGTCTGATGCCTTCTGGTGTGTCTAAAGGGAGCAATGGTG

ATGTACTCATATGCATAAAATAAATGAATAAATAAACAAATCTT
Translation
MRYRAS - UNI22071 - ALGSDGVRVTMESALTARDRVGVQDFVLLENFTSEAAFIENLRRRFRENLIY TYIGPVLVSVNPYRDLQIYSRQHMERY

RGVSFYEVPPHL LFAVADTVYRALRTERRDQAVMISGESGAGKTEATKRLLQFYAETCPAPERGGAVRDRLLQSNPVLE AFGNAKTLRNDNSSRFGKY

MDVQFDFK GAPVGGHILSYLLEKSRVVHQNHGERNFHVFYQLLEGGEEETLRRLGLERNPQSYLYLVK GQCAKVSSINDKSDWKVMRKALSVIDFTED

EVE DLLSIVASVLHLGNIHFAADEDSNAQVTTENQLKYLTR LLGVEGTTLREALTHRKIIAKGEE LLSPLNLEQAAYARDALAKAVYSRTFTWLVRK

INRSLASK DAESPSWRSTTVLGLLDIYGFEVFQHNS SFEQFCINYCNEKLQQLFIELTLKSEQEEYEAEGIA WEPVQYFNNKIICDLVEEKFKGIIS

IL DEECLRPGEATDLTFLEKLEDTVKPHPHFLT THKLADQKTRKSLDRGEFRLLHYAGEVTYSVTG GFLDKNNDLLFRNLKE TMCSSMNPIMAQCF

DKSELSDKKRPET VATQFKMSLLQLVEILRSKEPAYIRCIKPNDAKQPG GRFDEVLIRHQVKYLGLMENLRVRRAGFAYRRKYEAFLQR RYKSLCPE

TWPMWAGRPQDGVAVLVRHLGYKPEEYKMGR RTKIFIRFPKTLFATEDSLEVRRQSLA ATKIQAAWRGFHWRQKFLRVKRSA AICIQSWWRGTLGRR

KAAKRKWAAQTIRR RLIRGFILRHSPRCPENAFFLDHVRASFLLNLRRQLPRNVLDTSWPTPPPALRE ASELLRELCMKNMVWKYCRSISPEWKQQ L

QQKAVASEIFKGKKDNYPQSVPRLFISTRLG GTEEISPRVLQSLGSEPIQ YAVPVVKYDRKGYKPRPRQLLLTPSAVVIVEDAKVKQRIDYANLTG G

ISVSSLSDSLFVLHVQREDNKQK GDVVLQSDHVIETLTKTALSADRVNNININQGS SITFAGGPGRDGIIDFTSGSELLITKAKNGHLAV VAPRLNS

R
Transcript ENSMUST00000108427
Sequence
ATGTCCCTGAAAGTTGCTAGAACAGGAGGCCGAGGCGGAGAGGGCTGCAGAACGCTCGAACCCAGGACCATGTGGTCGCCCCTG - UNI22071 - GC

CCTGGGCAGTGACGGGGTTCGAGTGACCATGGAGAGCGCCTTGACTGCCCGAGACCGGGTAGGGGTGCAGGACTTTGTCCTGCTGGAGAATTTCACCAGT

GAGGCTGCCTTCATTGAGAACCTCCGGCGGCGGTTCCGGGAGAACCTCATTTAT ACCTACATCGGTCCTGTCCTAGTCTCTGTCAATCCCTACCGAGAC

CTACAGATCTACAGCCGGCAGCATATGGAACGCTACCGTGGTGTCAGTTTCTATGAAGTACCACCTCATTT GTTTGCAGTGGCTGACACTGTATACCGG

GCACTTCGTACTGAGCGTCGGGACCAGGCAGTGATGATTTCTGGAGAGAGTGGGGCAGGCAAGACAGAGGCCACCAAGAGACTGCTCCAGTTCTATGCAG

AGACCTGCCCAGCCCCTGAACGGGGTGGCGCAGTGCGAGACCGCCTGTTGCAGAGCAACCCCGTGTTAGAG
Translation
MSLKVARTGGRGGEGCRTLEPRTMWSPL - UNI22071 - ALGSDGVRVTMESALTARDRVGVQDFVLLENFTSEAAFIENLRRRFRENLIY  
Transcript ENSMUST00000069057
Sequence
GCGCGCGCCTGAGCCTGGGCCTTGCGGGGGATGACGATAGGCAGCGGCCCGGCCCCTAGCGGGCCCTGGGCGGAGAGATCGTACCGGGGTTGCGGACTCC

GGAGGTGGCCACGCCGTCCAGTCCAGCCCCCGCCCGATCACCCGAAGAACCAAGCCG - UNI22071 - - UNI29611 - - UNI33700 - GCC

CTGGGCAGTGACGGGGTTCGAGTGACCATGGAGAGCGCCTTGACTGCCCGAGACCGGGTAGGGGTGCAGGACTTTGTCCTGCTGGAGAATTTCACCAGTG

AGGCTGCCTTCATTGAGAACCTCCGGCGGCGGTTCCGGGAGAACCTCATTTAT ACCTACATCGGTCCTGTCCTAGTCTCTGTCAATCCCTACCGAGACC

TACAGATCTACAGCCGGCAGCATATGGAACGCTACCGTGGTGTCAGTTTCTATGAAGTACCACCTCATTT GTTTGCAGTGGCTGACACTGTATACCGGG

CACTTCGTACTGAGCGTCGGGACCAGGCAGTGATGATTTCTGGAGAGAGTGGGGCAGGCAAGACAGAGGCCACCAAGAGACTGCTCCAGTTCTATGCAGA

GACCTGCCCAGCCCCTGAACGGGGTGGCGCAGTGCGAGACCGCCTGTTGCAGAGCAACCCCGTGTTAGAG GCCTTTGGGAATGCCAAGACTCTCCGCAA

CGATAACTCCAGCCGGTTTGGAAAGTACATGGATGTGCAGTTTGACTTCAAG GGTGCCCCCGTGGGAGGCCACATTCTCAGTTACCTCCTGGAAAAGTC

CCGGGTGGTGCACCAAAATCACGGAGAGCGGAACTTCCACGTCTTTTACCAGCTACTGGAGGGGGGCGAGGAGGAGACTCTCCGTCGGCTGGGCTTGGAA

CGGAACCCCCAGAGCTACTTGTACCTGGTGAAG GGCCAGTGTGCCAAGGTCTCCTCCATCAACGACAAGAGTGACTGGAAGGTTATGAGGAAGGCGCTG

TCCGTCATTGACTTCACTGAGGATGAAGTGGAG GACTTGCTCAGCATCGTGGCCAGCGTCCTACATCTGGGCAACATCCACTTTGCTGCTGACGAGGAC

AGCAATGCCCAGGTTACTACTGAGAACCAGCTCAAATATCTGACCAGG CTCCTTGGTGTGGAAGGTACAACACTTAGGGAAGCCCTGACCCACAGGAAG

ATCATCGCCAAGGGGGAAGAG CTCCTGAGCCCACTGAACCTTGAACAGGCGGCATATGCAAGGGATGCGCTTGCCAAGGCTGTGTACAGCCGGACATTC

ACCTGGCTGGTCAGAAAGATCAATAGGTCACTGGCCTCTAAG GACGCTGAGAGCCCCAGCTGGCGAAGCACCACGGTTCTTGGGCTCCTGGACATTTAC

GGCTTTGAAGTGTTTCAGCATAACAG CTTCGAGCAGTTCTGCATCAACTACTGCAATGAGAAGCTGCAGCAGCTCTTCATCGAGCTGACTCTCAAGTCG

GAGCAGGAGGAATACGAGGCTGAGGGCATCGCG TGGGAACCTGTCCAGTACTTCAACAACAAGATCATCTGTGACCTGGTAGAGGAGAAGTTCAAGGGC

ATCATCTCCATCTTG GATGAAGAGTGCCTGCGTCCTGGGGAGGCCACGGACCTGACCTTTCTGGAGAAGTTGGAGGACACTGTCAAGCCCCACCCTCAC

TTCCTGAC GCACAAGCTCGCTGACCAGAAGACCAGGAAATCTCTAGACCGAGGGGAGTTCCGCCTTCTGCATTATGCTGGAGAGGTGACCTACAGTGTG

ACTG GGTTTCTGGATAAAAACAATGACCTCCTCTTCCGGAACCTGAAGGAG ACCATGTGCAGCTCAATGAACCCCATCATGGCCCAGTGCTTTGACAA

GAGTGAGCTCAGTGACAAGAAGCGGCCAGAGACG GTGGCCACCCAGTTCAAGATGAGCCTCCTGCAGCTCGTGGAGATCCTGAGGTCTAAGGAGCCTGC

CTATATCCGGTGCATCAAGCCAAACGACGCCAAGCAGCCGG GTCGCTTTGATGAGGTGCTCATCCGACATCAGGTGAAGTACCTGGGACTGATGGAGAA

TCTGCGCGTGCGCAGAGCTGGCTTTGCCTATCGTCGCAAATATGAGGCTTTCCTGCAGAG GTACAAGTCACTGTGCCCAGAGACATGGCCCATGTGGGC

AGGACGGCCCCAGGATGGTGTGGCCGTGTTGGTCAGACACCTCGGCTACAAGCCAGAAGAGTACAAAATGGGCAG GACTAAGATCTTCATCCGATTTCC

CAAGACCTTGTTTGCCACAGAGGACTCCCTGGAAGTCCGGCGGCAGAGTCTAG CCACCAAGATCCAGGCGGCCTGGAGGGGCTTTCATTGGCGACAGAA

ATTTCTCCGGGTGAAGCGATCAG CCATCTGTATCCAGTCATGGTGGCGTGGCACACTGGGCCGGAGGAAGGCAGCCAAGAGGAAGTGGGCAGCCCAGAC

CATCCGTCG ACTCATCCGTGGCTTCATTTTGCGCCATTCACCCCGGTGCCCTGAGAATGCCTTCTTCTTGGACCACGTGCGCGCCTCATTTTTGCTTAA

CCTGAGGCGGCAACTGCCCCGGAATGTTCTGGACACCTCCTGGCCCACACCCCCACCTGCCCTGAGAGAG GCCTCAGAACTGCTACGGGAACTGTGCAT

GAAGAACATGGTGTGGAAGTACTGCCGGAGCATCAGCCCTGAGTGGAAGCAGCAG CTGCAGCAAAAGGCGGTGGCTAGTGAAATTTTCAAGGGCAAGAA

GGACAACTACCCCCAGAGTGTCCCCAGACTCTTCATTAGCACACGGCTTG GCACAGAGGAGATCAGCCCCAGAGTGCTTCAATCCTTGGGCTCTGAACC

CATCCAG TATGCCGTGCCCGTGGTAAAATACGACCGTAAGGGTTACAAGCCTCGCCCCCGGCAGCTGCTGCTCACGCCCAGTGCTGTGGTCATTGTGGA

GGATGCTAAAGTCAAGCAGAGAATTGATTATGCCAACCTAACCG GAATCTCTGTCAGTAGCCTGAGTGATAGCCTATTTGTGCTTCACGTGCAGCGTGA

AGACAACAAGCAGAAG GGAGATGTGGTGCTGCAGAGTGATCATGTGATCGAGACACTAACCAAGACGGCCCTCAGTGCTGACCGCGTGAACAATATCAA

CATCAACCAGGGCAG CATAACGTTTGCAGGGGGTCCAGGCAGGGACGGCATCATTGACTTCACATCGGGCTCAGAGCTTCTCATCACCAAGGCTAAGAA

TGGCCACCTGGCTGTG GTGGCCCCACGGCTGAATTCTCGGTGATGAAGGCTTCAGTGGACCCCTCCTGACTCCTGATGCTTCGCTTAGTCCCCTCCTCC

CCTCCCAGTTACCAAAGACTCAAGCTTCCAGACAGGGATCCATGGACACCCTCAAAACCCACCTGCAAACTCCTGCCTCCTGCTCGCCCCCTCTCGAGGT

GATCAGGAGCCAGGGAGCTACCCCATGAGTGGGCCAGGCCGGGCCACAGCAATAGAAAAGCAGAGGCCTGAGCAGGCCAGGCCAGCCCTCTGCTGATGCC

AAATATCTAAGAGAAGGGAATTTTAACTGAGGTTTTCTCTGAGATTTTTTGATGCTTTATAGGAAACTATTTTTTTAAGAAAGCCATTTTCCTACCCTAA

ACACACTGGATGTGTTTTTCCCTGCCTCGAACAGGGCAAGGAATGTAACTGAAAGACTGACTGGGCTGGGCTGGAAGGTCCTCTTCTCTGGCCAAGCCTC

TCCTCATTCCCTTGTCTGTCTGTCCATCCACCTGCACCTTTTGCAGCCCACTATGACCTCCACCAAAAGGCTGAGGCCACCTCTGCCTACCCCATATTCC

TGCCTTAAGAATGTCCTTTTAGGGGCTGGGGTATAGCCCAGTGGTAGAACTGGTGCTAAGCATGTGTGAGACCCTGGGCTCAATCCCCAGCATTAAAAAA

TAAAAAATAGGTTTTTAATATTTTCACCCCAGTCTGAGGGCATCCCTAAAGTGGGGGAAAAGTCTTAAGAGTTTGGAAGTCTTCAGAGACAGTGTCTGGT

CCAGGCTCCTGGAATCTACAGAGCTGGAGACAGAGGCACACAGAGGGAGGGAAGACTTGCCTAGTAGAAGACTGAAGCAAATCCTAAAGTGAAGCCCGCC

CTCAGCACATCTCACTGCCTTTCCCAGGGACAGGGAGGCCCATAAGGCAAGGGTCGCGTCTCATGTATGCACCTGGCTCTCTGACCAGCAATCACCCTTG

GGAGCTACCGGGTGGGAGGGACTCTTCTGCCTGGGTCTATGCCTTAGGATGACAACCTCCATACACATACATACTTTCGACCCAATTTAAGAATGGTAGG

GTCTTTTATTGGCCTTGGGTGCCTCTGTGACCTGGGAGCCTAGGGACAGGGCTGGCCTTGGAGGAACTGCAGGGGCATCACCTCTTTCTGCTGCTTCTCT

CCACCCCAGAGGTCCTTGGGTTTGCCCAGCTCCCTCTGTGCCCTCTGGGGCTCTCAGCCCACTGCTGACACTTCTGCAATCCAGAGAAACACTAAATAAA

GCAATATGTATTTGCCAACACAGTCTTCCTGTGAGTGTGGAAAAGGGGCCCTAGAAGGTAGACATTCTTAAGGGGCTTGGCACTACAGAAGAAAGGAGAC

AGACCTACTTAGGAGCAATAGAGAGAAACCAAGTTAGGTGTGGTATTGTGAGCCTTAGTGCTCAGGAAGCAGGGACAGGAGGATTGGATTTCTTAGTTCT

AGGCCAGCCTGGTCTACAAATCAAGTTCCAGGGCTATATAGACAGGCACGGGGCTTTGGATTTGGGCAAATAAATACCTGGTCTGGCAGCACCGCTGGAC

TAAGGAGACCTAGCATGGGCAATATAAGCCCAGGGGCCTGTGCTGATGCAAGACTCAGGTGGGGAGGGTCAGCACTTCATAAGGAAGCTGGTGTTTGAGG

TATCTCAGGGGCTTGCTTCCAGTTCTGGGGATAAAGAATCCAGTCCAAAGTGGCTGGAGCGGTAAAGGCCACTTGTCAACAATGGCCATTTTATTGTCCT

GGGGAGATCTACTTCTAGGTGATCAAAAGACATTGTTAGGAAAATGTCTTGGGGGCTAGAGAGATGGCTCAGTGGTTAAGAGAACTGACTGCTCTTCTGA

AGGTCCTGAGTTCAATTCCCAGCAACTACACGGTGGCTCACAACCATCTGTAATGGGGTCTGATGCCTTCTGGTGTGTCTAAAGGGAGCAATGGTGATGT

ACTCATATGCATAAAATAAATGAATAAATAAACAAATCTT
Translation
 - UNI22071 - - UNI29611 - - UNI33700 - MESALTARDRVGVQDFVLLENFTSEAAFIENLRRRFRENLIY TYIGPVLVSVNPYRDLQ

IYSRQHMERYRGVSFYEVPPHL LFAVADTVYRALRTERRDQAVMISGESGAGKTEATKRLLQFYAETCPAPERGGAVRDRLLQSNPVLE AFGNAKTLR

NDNSSRFGKYMDVQFDFK GAPVGGHILSYLLEKSRVVHQNHGERNFHVFYQLLEGGEEETLRRLGLERNPQSYLYLVK GQCAKVSSINDKSDWKVMRK

ALSVIDFTEDEVE DLLSIVASVLHLGNIHFAADEDSNAQVTTENQLKYLTR LLGVEGTTLREALTHRKIIAKGEE LLSPLNLEQAAYARDALAKAVY

SRTFTWLVRKINRSLASK DAESPSWRSTTVLGLLDIYGFEVFQHNS SFEQFCINYCNEKLQQLFIELTLKSEQEEYEAEGIA WEPVQYFNNKIICDL

VEEKFKGIISIL DEECLRPGEATDLTFLEKLEDTVKPHPHFLT THKLADQKTRKSLDRGEFRLLHYAGEVTYSVTG GFLDKNNDLLFRNLKE TMCS

SMNPIMAQCFDKSELSDKKRPET VATQFKMSLLQLVEILRSKEPAYIRCIKPNDAKQPG GRFDEVLIRHQVKYLGLMENLRVRRAGFAYRRKYEAFLQ

R RYKSLCPETWPMWAGRPQDGVAVLVRHLGYKPEEYKMGR RTKIFIRFPKTLFATEDSLEVRRQSLA ATKIQAAWRGFHWRQKFLRVKRSA AICIQ

SWWRGTLGRRKAAKRKWAAQTIRR RLIRGFILRHSPRCPENAFFLDHVRASFLLNLRRQLPRNVLDTSWPTPPPALRE ASELLRELCMKNMVWKYCRS

ISPEWKQQ LQQKAVASEIFKGKKDNYPQSVPRLFISTRLG GTEEISPRVLQSLGSEPIQ YAVPVVKYDRKGYKPRPRQLLLTPSAVVIVEDAKVKQR

IDYANLTG GISVSSLSDSLFVLHVQREDNKQK GDVVLQSDHVIETLTKTALSADRVNNININQGS SITFAGGPGRDGIIDFTSGSELLITKAKNGHL

AV VAPRLNSR
Transcript ENSMUST00000102504
Sequence
GTGGGTTATGGAATCTCCAGCAAGTGCCTAGCTGAGTGCTTGCCTAAGACCGGAGCAGTCTCCCGGCAGTCTGACAAGGAAGCAGACGATTAGTACTTAA

TTTAGTAAGGAGGAGGCTGTGTGTTAGAGGAAAATAAGAAGGCGCTATGGCGAAGGTGATTCCTGAGCTGACTCTTCGGTGATGACTAAGTGAG - UNI

22071 - - UNI33700 - GCCCTGGGCAGTGACGGGGTTCGAGTGACCATGGAGAGCGCCTTGACTGCCCGAGACCGGGTAGGGGTGCAGGACTTTG

TCCTGCTGGAGAATTTCACCAGTGAGGCTGCCTTCATTGAGAACCTCCGGCGGCGGTTCCGGGAGAACCTCATTTAT ACCTACATCGGTCCTGTCCTAG

TCTCTGTCAATCCCTACCGAGACCTACAGATCTACAGCCGGCAGCATATGGAACGCTACCGTGGTGTCAGTTTCTATGAAGTACCACCTCATTT GTTTG

CAGTGGCTGACACTGTATACCGGGCACTTCGTACTGAGCGTCGGGACCAGGCAGTGATGATTTCTGGAGAGAGTGGGGCAGGCAAGACAGAGGCCACCAA

GAGACTGCTCCAGTTCTATGCAGAGACCTGCCCAGCCCCTGAACGGGGTGGCGCAGTGCGAGACCGCCTGTTGCAGAGCAACCCCGTGTTAGAG GCCTT

TGGGAATGCCAAGACTCTCCGCAACGATAACTCCAGCCGGTTTGGAAAGTACATGGATGTGCAGTTTGACTTCAAG GGTGCCCCCGTGGGAGGCCACAT

TCTCAGTTACCTCCTGGAAAAGTCCCGGGTGGTGCACCAAAATCACGGAGAGCGGAACTTCCACGTCTTTTACCAGCTACTGGAGGGGGGCGAGGAGGAG

ACTCTCCGTCGGCTGGGCTTGGAACGGAACCCCCAGAGCTACTTGTACCTGGTGAAG GGCCAGTGTGCCAAGGTCTCCTCCATCAACGACAAGAGTGAC

TGGAAGGTTATGAGGAAGGCGCTGTCCGTCATTGACTTCACTGAGGATGAAGTGGAG GACTTGCTCAGCATCGTGGCCAGCGTCCTACATCTGGGCAAC

ATCCACTTTGCTGCTGACGAGGACAGCAATGCCCAGGTTACTACTGAGAACCAGCTCAAATATCTGACCAGG CTCCTTGGTGTGGAAGGTACAACACTT

AGGGAAGCCCTGACCCACAGGAAGATCATCGCCAAGGGGGAAGAG CTCCTGAGCCCACTGAACCTTGAACAGGCGGCATATGCAAGGGATGCGCTTGCC

AAGGCTGTGTACAGCCGGACATTCACCTGGCTGGTCAGAAAGATCAATAGGTCACTGGCCTCTAAG GACGCTGAGAGCCCCAGCTGGCGAAGCACCACG

GTTCTTGGGCTCCTGGACATTTACGGCTTTGAAGTGTTTCAGCATAACAG CTTCGAGCAGTTCTGCATCAACTACTGCAATGAGAAGCTGCAGCAGCTC

TTCATCGAGCTGACTCTCAAGTCGGAGCAGGAGGAATACGAGGCTGAGGGCATCGCG TGGGAACCTGTCCAGTACTTCAACAACAAGATCATCTGTGAC

CTGGTAGAGGAGAAGTTCAAGGGCATCATCTCCATCTTG GATGAAGAGTGCCTGCGTCCTGGGGAGGCCACGGACCTGACCTTTCTGGAGAAGTTGGAG

GACACTGTCAAGCCCCACCCTCACTTCCTGAC GCACAAGCTCGCTGACCAGAAGACCAGGAAATCTCTAGACCGAGGGGAGTTCCGCCTTCTGCATTAT

GCTGGAGAGGTGACCTACAGTGTGACTG GGTTTCTGGATAAAAACAATGACCTCCTCTTCCGGAACCTGAAGGAG ACCATGTGCAGCTCAATGAACCC

CATCATGGCCCAGTGCTTTGACAAGAGTGAGCTCAGTGACAAGAAGCGGCCAGAGACG GTGGCCACCCAGTTCAAGATGAGCCTCCTGCAGCTCGTGGA

GATCCTGAGGTCTAAGGAGCCTGCCTATATCCGGTGCATCAAGCCAAACGACGCCAAGCAGCCGG GTCGCTTTGATGAGGTGCTCATCCGACATCAGGT

GAAGTACCTGGGACTGATGGAGAATCTGCGCGTGCGCAGAGCTGGCTTTGCCTATCGTCGCAAATATGAGGCTTTCCTGCAGAG GTACAAGTCACTGTG

CCCAGAGACATGGCCCATGTGGGCAGGACGGCCCCAGGATGGTGTGGCCGTGTTGGTCAGACACCTCGGCTACAAGCCAGAAGAGTACAAAATGGGCAG 

GACTAAGATCTTCATCCGATTTCCCAAGACCTTGTTTGCCACAGAGGACTCCCTGGAAGTCCGGCGGCAGAGTCTAG CCACCAAGATCCAGGCGGCCTG

GAGGGGCTTTCATTGGCGACAGAAATTTCTCCGGGTGAAGCGATCAG CCATCTGTATCCAGTCATGGTGGCGTGGCACACTGGGCCGGAGGAAGGCAGC

CAAGAGGAAGTGGGCAGCCCAGACCATCCGTCG ACTCATCCGTGGCTTCATTTTGCGCCATTCACCCCGGTGCCCTGAGAATGCCTTCTTCTTGGACCA

CGTGCGCGCCTCATTTTTGCTTAACCTGAGGCGGCAACTGCCCCGGAATGTTCTGGACACCTCCTGGCCCACACCCCCACCTGCCCTGAGAGAG GCCTC

AGAACTGCTACGGGAACTGTGCATGAAGAACATGGTGTGGAAGTACTGCCGGAGCATCAGCCCTGAGTGGAAGCAGCAG CTGCAGCAAAAGGCGGTGGC

TAGTGAAATTTTCAAGGGCAAGAAGGACAACTACCCCCAGAGTGTCCCCAGACTCTTCATTAGCACACGGCTTG GCACAGAGGAGATCAGCCCCAGAGT

GCTTCAATCCTTGGGCTCTGAACCCATCCAG TATGCCGTGCCCGTGGTAAAATACGACCGTAAGGGTTACAAGCCTCGCCCCCGGCAGCTGCTGCTCAC

GCCCAGTGCTGTGGTCATTGTGGAGGATGCTAAAGTCAAGCAGAGAATTGATTATGCCAACCTAACCG GAATCTCTGTCAGTAGCCTGAGTGATAGCCT

ATTTGTGCTTCACGTGCAGCGTGAAGACAACAAGCAGAAG GGAGATGTGGTGCTGCAGAGTGATCATGTGATCGAGACACTAACCAAGACGGCCCTCAG

TGCTGACCGCGTGAACAATATCAACATCAACCAGGGCAG CATAACGTTTGCAGGGGGTCCAGGCAGGGACGGCATCATTGACTTCACATCGGGCTCAGA

GCTTCTCATCACCAAGGCTAAGAATGGCCACCTGGCTGTG GTGGCCCCACGGCTGAATTCTCGGTGATGAAGGCTTCAGTGGACCCCTCCTGACTCCTG

ATGCTTCGCTTAGTCCCCTCCTCCCCTCCCAGTTACCAAAGACTCAAGCTTCCAGACAGGGATCCATGGACACCCTCAAAACCCACCTGCAAACTCCTGC

CTCCTGCTCGCCCCCTCTCGAGGTGATCAGGAGCCAGGGAGCTACCCCATGAGTGGGCCAGGCCGGGCCACAGCAATAGAAAAGCAGAGGCCTGAGCAGG

CCAGGCCAGCCCTCTGCTGATGCCAAATATCTAAGAGAAGGGAATTTTAACTGAGGTTTTCTCTGAGATTTTTTGATGCTTTATAGGAAACTATTTTTTT

AAGAAAGCCATTTTCCTACCCTAAACACACTGGATGTGTTTTTCCCTGCCTCGAACAGGGCAAGGAATGTAACTGAAAGACTGACTGGGCTGGGCTGGAA

GGTCCTCTTCTCTGGCCAAGCCTCTCCTCATTCCCTTGTCTGTCTGTCCATCCACCTGCACCTTTTGCAGCCCACTATGACCTCCACCAAAAGGCTGAGG

CCACCTCTGCCTACCCCATATTCCTGCCTTAAGAATGTCCTTTTAGGGGCTGGGGTATAGCCCAGTGGTAGAACTGGTGCTAAGCATGTGTGAGACCCTG

GGCTCAATCCCCAGCATTAAAAAATAAAAAATAGGTTTTTAATATTTTCACCCCAGTCTGAGGGCATCCCTAAAGTGGGGGAAAAGTCTTAAGAGTTTGG

AAGTCTTCAGAGACAGTGTCTGGTCCAGGCTCCTGGAATCTACAGAGCTGGAGACAGAGGCACACAGAGGGAGGGAAGACTTGCCTAGTAGAAGACTGAA

GCAAATCCTAAAGTGAAGCCCGCCCTCAGCACATCTCACTGCCTTTCCCAGGGACAGGGAGGCCCATAAGGCAAGGGTCGCGTCTCATGTATGCACCTGG

CTCTCTGACCAGCAATCACCCTTGGGAGCTACCGGGTGGGAGGGACTCTTCTGCCTGGGTCTATGCCTTAGGATGACAACCTCCATACACATACATACTT

TCGACCCAATTTAAGAATGGTAGGGTCTTTTATTGGCCTTGGGTGCCTCTGTGACCTGGGAGCCTAGGGACAGGGCTGGCCTTGGAGGAACTGCAGGGGC

ATCACCTCTTTCTGCTGCTTCTCTCCACCCCAGAGGTCCTTGGGTTTGCCCAGCTCCCTCTGTGCCCTCTGGGGCTCTCAGCCCACTGCTGACACTTCTG

CAATCCAGAGAAACACTAAATAAAGCAATATGTATTTGCCAACACAGTCTTCCTGTGAGTGTGGAAAAGGGGCCCTAGAAGGTAGACATTCTTAAGGGGC

TTGGCACTACAGAAGAAAGGAGACAGACCTACTTAGGAGCAATAGAGAGAAACCAAGTTAGGTGTGGTATTGTGAGCCTTAGTGCTCAGGAAGCAGGGAC

AGGAGGATTGGATTTCTTAGTTCTAGGCCAGCCTGGTCTACAAATCAAGTTCCAGGGCTATATAGACAGGCACGGGGCTTTGGATTTGGGCAAATAAATA

CCTGGTCTGGCAGCACCGCTGGACTAAGGAGACCTAGCATGGGCAATATAAGCCCAGGGGCCTGTGCTGATGCAAGACTCAGGTGGGGAGGGTCAGCACT

TCATAAGGAAGCTGGTGTTTGAGGTATCTCAGGGGCTTGCTTCCAGTTCTGGGGATAAAGAATCCAGTCCAAAGTGGCTGGAGCGGTAAAGGCCACTTGT

CAACAATGGCCATTTTATTGTCCTGGGGAGATCTACTTCTAGGTGATCAAAAGACATTGTTAGGAAAATGTCTTGGGGGCTAGAGAGATGGCTCAGTGGT

TAAGAGAACTGACTGCTCTTCTGAAGGTCCTGAGTTCAATTCCCAGCAACTACACGGTGGCTCACAACCATCTGTAATGGGGTCTGATGCCTTCTGGTGT

GTCTAAAGGGAGCAATGGTGATGTACTCATATGCATAAAATAAATGAATAAATAAACAAATCTT
Translation
 - UNI22071 - - UNI33700 - MESALTARDRVGVQDFVLLENFTSEAAFIENLRRRFRENLIY TYIGPVLVSVNPYRDLQIYSRQHMERYRGV

SFYEVPPHL LFAVADTVYRALRTERRDQAVMISGESGAGKTEATKRLLQFYAETCPAPERGGAVRDRLLQSNPVLE AFGNAKTLRNDNSSRFGKYMDV

QFDFK GAPVGGHILSYLLEKSRVVHQNHGERNFHVFYQLLEGGEEETLRRLGLERNPQSYLYLVK GQCAKVSSINDKSDWKVMRKALSVIDFTEDEVE

 DLLSIVASVLHLGNIHFAADEDSNAQVTTENQLKYLTR LLGVEGTTLREALTHRKIIAKGEE LLSPLNLEQAAYARDALAKAVYSRTFTWLVRKINR

SLASK DAESPSWRSTTVLGLLDIYGFEVFQHNS SFEQFCINYCNEKLQQLFIELTLKSEQEEYEAEGIA WEPVQYFNNKIICDLVEEKFKGIISIL 

DEECLRPGEATDLTFLEKLEDTVKPHPHFLT THKLADQKTRKSLDRGEFRLLHYAGEVTYSVTG GFLDKNNDLLFRNLKE TMCSSMNPIMAQCFDKS

ELSDKKRPET VATQFKMSLLQLVEILRSKEPAYIRCIKPNDAKQPG GRFDEVLIRHQVKYLGLMENLRVRRAGFAYRRKYEAFLQR RYKSLCPETWP

MWAGRPQDGVAVLVRHLGYKPEEYKMGR RTKIFIRFPKTLFATEDSLEVRRQSLA ATKIQAAWRGFHWRQKFLRVKRSA AICIQSWWRGTLGRRKAA

KRKWAAQTIRR RLIRGFILRHSPRCPENAFFLDHVRASFLLNLRRQLPRNVLDTSWPTPPPALRE ASELLRELCMKNMVWKYCRSISPEWKQQ LQQK

AVASEIFKGKKDNYPQSVPRLFISTRLG GTEEISPRVLQSLGSEPIQ YAVPVVKYDRKGYKPRPRQLLLTPSAVVIVEDAKVKQRIDYANLTG GISV

SSLSDSLFVLHVQREDNKQK GDVVLQSDHVIETLTKTALSADRVNNININQGS SITFAGGPGRDGIIDFTSGSELLITKAKNGHLAV VAPRLNSR
Transcript ENSMUST00000057572
Sequence
CCGGCCAGGCCGGCTGCAGTGGGTCCTAGGGTCGGGACTCCGAGCCCCCTGAGCCAAGGGGCCTGCAAGGGGCGGTGCAGGGGGCGGGCTGGCCCCTCCC

TCGGTTACGCCGCGGCCGAGTACAGACCAAGAGGCGCGGGCAGCGGAGCGGGGCGCCGGGTCCGGCAGGATGCGCTACCGGGCATCG - UNI22071 -

 GCCCTGGGCAGTGACGGGGTTCGAGTGACCATGGAGAGCGCCTTGACTGCCCGAGACCGGGTAGGGGTGCAGGACTTTGTCCTGCTGGAGAATTTCACC

AGTGAGGCTGCCTTCATTGAGAACCTCCGGCGGCGGTTCCGGGAGAACCTCATTTAT ACCTACATCGGTCCTGTCCTAGTCTCTGTCAATCCCTACCGA

GACCTACAGATCTACAGCCGGCAGCATATGGAACGCTACCGTGGTGTCAGTTTCTATGAAGTACCACCTCATTT GTTTGCAGTGGCTGACACTGTATAC

CGGGCACTTCGTACTGAGCGTCGGGACCAGGCAGTGATGATTTCTGGAGAGAGTGGGGCAGGCAAGACAGAGGCCACCAAGAGACTGCTCCAGTTCTATG

CAGAGACCTGCCCAGCCCCTGAACGGGGTGGCGCAGTGCGAGACCGCCTGTTGCAGAGCAACCCCGTGTTAGAG GCCTTTGGGAATGCCAAGACTCTCC

GCAACGATAACTCCAGCCGGTTTGGAAAGTACATGGATGTGCAGTTTGACTTCAAG GGTGCCCCCGTGGGAGGCCACATTCTCAGTTACCTCCTGGAAA

AGTCCCGGGTGGTGCACCAAAATCACGGAGAGCGGAACTTCCACGTCTTTTACCAGCTACTGGAGGGGGGCGAGGAGGAGACTCTCCGTCGGCTGGGCTT

GGAACGGAACCCCCAGAGCTACTTGTACCTGGTGAAG GGCCAGTGTGCCAAGGTCTCCTCCATCAACGACAAGAGTGACTGGAAGGTTATGAGGAAGGC

GCTGTCCGTCATTGACTTCACTGAGGATGAAGTGGAG GACTTGCTCAGCATCGTGGCCAGCGTCCTACATCTGGGCAACATCCACTTTGCTGCTGACGA

GGACAGCAATGCCCAGGTTACTACTGAGAACCAGCTCAAATATCTGACCAGG CTCCTTGGTGTGGAAGGTACAACACTTAGGGAAGCCCTGACCCACAG

GAAGATCATCGCCAAGGGGGAAGAG CTCCTGAGCCCACTGAACCTTGAACAGGCGGCATATGCAAGGGATGCGCTTGCCAAGGCTGTGTACAGCCGGAC

ATTCACCTGGCTGGTCAGAAAGATCAATAGGTCACTGGCCTCTAAG GACGCTGAGAGCCCCAGCTGGCGAAGCACCACGGTTCTTGGGCTCCTGGACAT

TTACGGCTTTGAAGTGTTTCAGCATAACAG CTTCGAGCAGTTCTGCATCAACTACTGCAATGAGAAGCTGCAGCAGCTCTTCATCGAGCTGACTCTCAA

GTCGGAGCAGGAGGAATACGAGGCTGAGGGCATCGCG TGGGAACCTGTCCAGTACTTCAACAACAAGATCATCTGTGACCTGGTAGAGGAGAAGTTCAA

GGGCATCATCTCCATCTTG GATGAAGAGTGCCTGCGTCCTGGGGAGGCCACGGACCTGACCTTTCTGGAGAAGTTGGAGGACACTGTCAAGCCCCACCC

TCACTTCCTGAC GCACAAGCTCGCTGACCAGAAGACCAGGAAATCTCTAGACCGAGGGGAGTTCCGCCTTCTGCATTATGCTGGAGAGGTGACCTACAG

TGTGACTG GGTTTCTGGATAAAAACAATGACCTCCTCTTCCGGAACCTGAAGGAG ACCATGTGCAGCTCAATGAACCCCATCATGGCCCAGTGCTTTG

ACAAGAGTGAGCTCAGTGACAAGAAGCGGCCAGAGACG GTGGCCACCCAGTTCAAGATGAGCCTCCTGCAGCTCGTGGAGATCCTGAGGTCTAAGGAGC

CTGCCTATATCCGGTGCATCAAGCCAAACGACGCCAAGCAGCCGG GTCGCTTTGATGAGGTGCTCATCCGACATCAGGTGAAGTACCTGGGACTGATGG

AGAATCTGCGCGTGCGCAGAGCTGGCTTTGCCTATCGTCGCAAATATGAGGCTTTCCTGCAGAG GTACAAGTCACTGTGCCCAGAGACATGGCCCATGT

GGGCAGGACGGCCCCAGGATGGTGTGGCCGTGTTGGTCAGACACCTCGGCTACAAGCCAGAAGAGTACAAAATGGGCAG GACTAAGATCTTCATCCGAT

TTCCCAAGACCTTGTTTGCCACAGAGGACTCCCTGGAAGTCCGGCGGCAGAGTCTAG CCACCAAGATCCAGGCGGCCTGGAGGGGCTTTCATTGGCGAC

AGAAATTTCTCCGGGTGAAGCGATCAG CCATCTGTATCCAGTCATGGTGGCGTGGCACACTGGGCCGGAGGAAGGCAGCCAAGAGGAAGTGGGCAGCCC

AGACCATCCGTCG ACTCATCCGTGGCTTCATTTTGCGCCATTCACCCCGGTGCCCTGAGAATGCCTTCTTCTTGGACCACGTGCGCGCCTCATTTTTGC

TTAACCTGAGGCGGCAACTGCCCCGGAATGTTCTGGACACCTCCTGGCCCACACCCCCACCTGCCCTGAGAGAG GCCTCAGAACTGCTACGGGAACTGT

GCATGAAGAACATGGTGTGGAAGTACTGCCGGAGCATCAGCCCTGAGTGGAAGCAGCAG CTGCAGCAAAAGGCGGTGGCTAGTGAAATTTTCAAGGGCA

AGAAGGACAACTACCCCCAGAGTGTCCCCAGACTCTTCATTAGCACACGGCTTG GCACAGAGGAGATCAGCCCCAGAGTGCTTCAATCCTTGGGCTCTG

AACCCATCCAG TATGCCGTGCCCGTGGTAAAATACGACCGTAAGGGTTACAAGCCTCGCCCCCGGCAGCTGCTGCTCACGCCCAGTGCTGTGGTCATTG

TGGAGGATGCTAAAGTCAAGCAGAGAATTGATTATGCCAACCTAACCG GAATCTCTGTCAGTAGCCTGAGTGATAGCCTATTTGTGCTTCACGTGCAGC

GTGAAGACAACAAGCAGAAG GGAGATGTGGTGCTGCAGAGTGATCATGTGATCGAGACACTAACCAAGACGGCCCTCAGTGCTGACCGCGTGAACAATA

TCAACATCAACCAGGGCAG CATAACGTTTGCAGGGGGTCCAGGCAGGGACGGCATCATTGACTTCACATCGGGCTCAGAGCTTCTCATCACCAAGGCTA

AGAATGGCCACCTGGCTGTG GTGGCCCCACGGCTGAATTCTCGGTGATGAAGGCTTCAGTGGACCCCTCCTGACTCCTGATGCTTCGCTTAGTCCCCTC

CTCCCCTCCCAGTTACCAAAGACTCAAGCTTCCAGACAGGGATCCATGGACACCCTCAAAACCCACCTGCAAACTCCTGCCTCCTGCTCGCCCCCTCTCG

AGGTGATCAGGAGCCAGGGAGCTACCCCATGAGTGGGCCAGGCCGGGCCACAGCAATAGAAAAGCAGAGGCCTGAGCAGGCCAGGCCAGCCCTCTGCTGA

TGCCAAATATCTAAGAGAAGGGAATTTTAACTGAGGTTTTCTCTGAGATTTTTTGATGCTTTATAGGAAACTATTTTTTTAAGAAAGCCATTTTCCTACC

CTAAACACACTGGATGTGTTTTTCCCTGCCTCGAACAGGGCAAGGAATGTAACTGAAAGACTGACTGGGCTGGGCTGGAAGGTCCTCTTCTCTGGCCAAG

CCTCTCCTCATTCCCTTGTCTGTCTGTCCATCCACCTGCACCTTTTGCAGCCCACTATGACCTCCACCAAAAGGCTGAGGCCACCTCTGCCTACCCCATA

TTCCTGCCTTAAGAATGTCCTTTTAGGGGCTGGGGTATAGCCCAGTGGTAGAACTGGTGCTAAGCATGTGTGAGACCCTGGGCTCAATCCCCAGCATTAA

AAAATAAAAAATAGGTTTTTAATATTTTCACCCCAGTCTGAGGGCATCCCTAAAGTGGGGGAAAAGTCTTAAGAGTTTGGAAGTCTTCAGAGACAGTGTC

TGGTCCAGGCTCCTGGAATCTACAGAGCTGGAGACAGAGGCACACAGAGGGAGGGAAGACTTGCCTAGTAGAAGACTGAAGCAAATCCTAAAGTGAAGCC

CGCCCTCAGCACATCTCACTGCCTTTCCCAGGGACAGGGAGGCCCATAAGGCAAGGGTCGCGTCTCATGTATGCACCTGGCTCTCTGACCAGCAATCACC

CTTGGGAGCTACCGGGTGGGAGGGACTCTTCTGCCTGGGTCTATGCCTTAGGATGACAACCTCCATACACATACATACTTTCGACCCAATTTAAGAATGG

TAGGGTCTTTTATTGGCCTTGGGTGCCTCTGTGACCTGGGAGCCTAGGGACAGGGCTGGCCTTGGAGGAACTGCAGGGGCATCACCTCTTTCTGCTGCTT

CTCTCCACCCCAGAGGTCCTTGGGTTTGCCCAGCTCCCTCTGTGCCCTCTGGGGCTCTCAGCCCACTGCTGACACTTCTGCAATCCAGAGAAACACTAAA

TAAAGCAATATGTATTTGCCAACACAGTCTTCCTGTGAGTGTGGAAAAGGGGCCCTAGAAGGTAGACATTCTTAAGGGGCTTGGCACTACAGAAGAAAGG

AGACAGACCTACTTAGGAGCAATAGAGAGAAACCAAGTTAGGTGTGGTATTGTGAGCCTTAGTGCTCAGGAAGCAGGGACAGGAGGATTGGATTTCTTAG

TTCTAGGCCAGCCTGGTCTACAAATCAAGTTCCAGGGCTATATAGACAGGCACGGGGCTTTGGATTTGGGCAAATAAATACCTGGTCTGGCAGCACCGCT

GGACTAAGGAGACCTAGCATGGGCAATATAAGCCCAGGGGCCTGTGCTGATGCAAGACTCAGGTGGGGAGGGTCAGCACTTCATAAGGAAGCTGGTGTTT

GAGGTATCTCAGGGGCTTGCTTCCAGTTCTGGGGATAAAGAATCCAGTCCAAAGTGGCTGGAGCGGTAAAGGCCACTTGTCAACAATGGCCATTTTATTG

TCCTGGGGAGATCTACTTCTAGGTGATCAAAAGACATTGTTAGGAAAATGTCTTGGGGGCTAGAGAGATGGCTCAGTGGTTAAGAGAACTGACTGCTCTT

CTGAAGGTCCTGAGTTCAATTCCCAGCAACTACACGGTGGCTCACAACCATCTGTAATGGGGTCTGATGCCTTCTGGTGTGTCTAAAGGGAGCAATGGTG

ATGTACTCATATGCATAAAATAAATGAATAAATAAACAAATCTT
Translation
 - UNI22071 - MESALTARDRVGVQDFVLLENFTSEAAFIENLRRRFRENLIY TYIGPVLVSVNPYRDLQIYSRQHMERYRGVSFYEVPPHL LFA

VADTVYRALRTERRDQAVMISGESGAGKTEATKRLLQFYAETCPAPERGGAVRDRLLQSNPVLE AFGNAKTLRNDNSSRFGKYMDVQFDFK GAPVGGH

ILSYLLEKSRVVHQNHGERNFHVFYQLLEGGEEETLRRLGLERNPQSYLYLVK GQCAKVSSINDKSDWKVMRKALSVIDFTEDEVE DLLSIVASVLHL

GNIHFAADEDSNAQVTTENQLKYLTR LLGVEGTTLREALTHRKIIAKGEE LLSPLNLEQAAYARDALAKAVYSRTFTWLVRKINRSLASK DAESPSW

RSTTVLGLLDIYGFEVFQHNS SFEQFCINYCNEKLQQLFIELTLKSEQEEYEAEGIA WEPVQYFNNKIICDLVEEKFKGIISIL DEECLRPGEATDL

TFLEKLEDTVKPHPHFLT THKLADQKTRKSLDRGEFRLLHYAGEVTYSVTG GFLDKNNDLLFRNLKE TMCSSMNPIMAQCFDKSELSDKKRPET VA

TQFKMSLLQLVEILRSKEPAYIRCIKPNDAKQPG GRFDEVLIRHQVKYLGLMENLRVRRAGFAYRRKYEAFLQR RYKSLCPETWPMWAGRPQDGVAVL

VRHLGYKPEEYKMGR RTKIFIRFPKTLFATEDSLEVRRQSLA ATKIQAAWRGFHWRQKFLRVKRSA AICIQSWWRGTLGRRKAAKRKWAAQTIRR R

LIRGFILRHSPRCPENAFFLDHVRASFLLNLRRQLPRNVLDTSWPTPPPALRE ASELLRELCMKNMVWKYCRSISPEWKQQ LQQKAVASEIFKGKKDN

YPQSVPRLFISTRLG GTEEISPRVLQSLGSEPIQ YAVPVVKYDRKGYKPRPRQLLLTPSAVVIVEDAKVKQRIDYANLTG GISVSSLSDSLFVLHVQ

REDNKQK GDVVLQSDHVIETLTKTALSADRVNNININQGS SITFAGGPGRDGIIDFTSGSELLITKAKNGHLAV VAPRLNSR

For any suggestions or comments, please send an email to unitrap@crg.es