Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000017831 (Rab5a)
Chromosomal location
Chr 17: 53618559 - 53646996 (+)
Description
RAB5A, member RAS oncogene family Gene [Source:MGI Symbol;Acc:MGI:105926]
RefSeq_dna
NM_025887 
RefSeq_peptide
NP_080163.1 
UniGene
Mm.329123 Mm.474016 
MGI
MGI:105926 
Uniprot/SWISSPROT
Q9CQD1 
Uniprot/SPTREMBL
Q3UCX7 Q4VAA1 
Human Ortholog
ENSG00000144566 (RAB5A)
Omim not available
UniTrap UNI19128
Vector Insertion
Chr 17: 53618934 - 53623145
Public Clones IST11632D3 (tigm) IST14319A9 (tigm)
Private Clones OST403968 (lexicon) OST321195 (lexicon) OST176719 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6704
Vector Insertion
Chr 17: 53623401 - 53636851
Public Clones BGC520 (baygenomics) XH206 (baygenomics) BGC512 (baygenomics)
Private Clones OST427098 (lexicon) OST381336 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000017975
Sequence
GGCTACGTGGCGGAGCCGGCGGAAGCAGTTCCTGCGCTGGAGCCCGAGTGTTTGTGTTTTGGTTCGTGAGGAGCCGGGGCGGTCTGAGGGGAGGAGACCG

AGGGAGGAGGAGGAGGAGAACGACGACGACGAGGAAGAAGTCCTCGGAACTCGAGCGCGGCGACTCTGGAGGAGGAGGAGAAAGGAAGGCGGAACGGAGA

GGCGGAGACGCAGCCCGGCAGGGGCGGCGGCACGGCGGGCGGCGCTCAGAGTCCCGCGCCGGCCAGGGTGAGAAGAAGGAGCGAGCAGGCGACGCCGCCG

CTGCAGCCGCGGCGCATCCGATCTCCGGGCCGGGCCGGGCCGTGCGTGGCCTCGCTGCCGGGAGACGCGGCCCAG - UNI19128 - GTAATTTCTCC

AGAAAGAAAACAAAATTAATGCCTTGCATCCTGGAAGTTCATTTAGGAATCTGAAATTAGGGACTTCTTTAAAATTTGGACATGGCTAATCGAGGAGCAA

CAAGACCCAACGGGCCAAATACTGGAAATAAAATATGCCAGTTCAAACTGGTCCTTCTAGGAGAGTCTGCTGTTGGCAAATCAAGCCTGGTTCTTCGCTT

TGTGAAAGGCCAATTTCATGAATTTCAAGAGAGTACCATTGGGG - UNI6704 - CTGCCTTTCTAACCCAAACTGTGTGTCTTGATGACACAACAGT

AAAATTTGAAATATGGGATACAGCTGGTCAAGAACGGTATCATAGCTTAGCACCAATGTACTACCGAGGAGCACAAGCAGCCATAGTTGTGTATGATATC

ACAAATGAG GAATCCTTTGCGAGAGCAAAAAACTGGGTTAAAGAACTTCAAAGGCAAGCAAGTCCTAATATTGTGATAGCTTTGTCAGGAAACAAAGCT

GACTTAGCAAATAAAAGAGCTGTTGACTTCCAG GAAGCACAGTCCTATGCAGATGACAACAGCTTATTATTTATGGAGACATCAGCTAAGACATCAATG

AATGTAAATGAAATATTTATGGCAATAG CTAAAAAGCTGCCAAAGAATGAACCACAGAATCCTGGTGCAAACTCAGCCAGAGGACGAGGAGTAGACCTT

ACTGAGCCTGCACAGCCAGCCAGAAGCCAGTGTTGTAGTAACTGAGCTCCAGTGTGAACTTCCTGAATGGCAAAAACCATGGAGTTGGGAGCATTTAGCC

GGCCCAGTGTGACTTCCAAAAAGAGACTATGGTAGAATCAAGTTTCTAATTCTGAATTATTTTGAGTGTTTTGAACTTAATTTTTAATAACATGCATGTG

CTCCTCCAGCAGTAGAAAGGAAAATGAGGACTGTGTGTACACTTGTTCCATGTGAAAGTGCAGGGGAACAGCTCATCTCCAGTGGGTATGGACCCACTCT

TAACCCACCCAGTCTCCAAACTGGGATAATAGTCAGGAATGACATGTTCAAAATTACTAATGTATGCTTTAGAAAACATTTTTAGAAGACTTACGCTTAA

CAATAAAACCCAAGCAAATGGTGTAATTTGATTTTCTTAAAAAGTCTACATTTCACATATTAATAAAGCAATCCCAACAAAACAGTCTTGCATCTCCAGA

AAGAAGGAATGAATATTGATGACATCTTAATTTTATTCAGTCCCATTACTTCTTAAAATTTGATTGAAAAAATTAAGTCACATGTAACCCCATGCTGTTT

TAGGAATATGAAACCGATAAATGCATTTTAATGATAGTGGTCCCTTCATATGAGCTTCTTTTAAAAAGTGGAAACAAACCAGGTATCTGCTTTCTAGTTA

ATCACTGTTGGCTATTCCATAGAGGTGTGTCTGGAACAGGGAGGGGGCTCTGCTTCCCTTTGGGCATAATTAGTCAGTGCACTAACAATTATGTACATTC

AAACTTGATTATTTTAAATATGATCTTCAGCTGTACTGTAAATAGAGTACTGCATTGTAGTCTCCATATGTTTATTATTTCCTATAATATTTAAGAATTG

CCTAAACATATACAAAATGTACAGTTACTAAAACAGCTAATTATTTCTTTCTTCCCCTATGAAAGGAAGGGGCTTTGCTGTTCTTACATGGCTAGAACCA

TAATAAACAATGTACTTGCAATTGTAACATAAGTATTACAATGTTATTAGTAATAATCTTGAAGCCTTGTTTTTTGAAGTCCATTTTATTTTAATCAGTA

TATTGCACTAATTATTTTAGGTATTTTCATTATATGAAATCTACCATGTGTCAGATGATTTAATCTATTTAAGTGTTGATCTGCTAGCAGAACTTGTACA

TTTTACAGTAACTCAAAACTAGTAAGGAGAACAGTTCACCGGTGTTTAGTTTTATATTGAGGTGCTCAGGTTGGAATAAAGTGATGT
Translation
 - UNI19128 - MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGA - UNI6704 - AAFLTQTVCLDDTTVKFE

IWDTAGQERYHSLAPMYYRGAQAAIVVYDITNE ESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQ EAQSYADDNSLLFMETSAKTSMNV

NEIFMAIA AKKLPKNEPQNPGANSARGRGVDLTEPAQPARSQCCSN

For any suggestions or comments, please send an email to unitrap@crg.es