Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000018076 (Med13l)
Chromosomal location
Chr 5: 119010752 - 119212989 (+)
Description
mediator complex subunit 13-like Gene [Source:MGI Symbol;Acc:MGI:2670178]
RefSeq_peptide
NP_766012.3 
MGI
MGI:2670178 
Uniprot/SWISSPROT
Q6JPI3 
Uniprot/SPTREMBL
Q3TDJ7 Q6GQS5 
Human Ortholog
ENSG00000123066 (MED13L)
Omim 608808 - TRANSPOSITION OF THE GREAT ARTERIES, DEXTRO-LOOPED 1  
UniTrap UNI8731
Vector Insertion
Chr 5: 119010867 - 119043341
Public Clones (sanger) XN687 (baygenomics) IST14466E4 (tigm) IST10126F12 (tigm)
Private Clones OST311787 (lexicon) OST249482 (lexicon) OST192247 (lexicon) OST188908 (lexicon)
OST187190 (lexicon) OST138980 (lexicon) OST126660 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6313
Vector Insertion
Chr 5: 119043580 - 119121021
Public Clones CSD339 (baygenomics) (egtc) IST13824D6 (tigm) IST12508E11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37544
Vector Insertion
Chr 5: 119121107 - 119130896
Public Clones (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI357
Vector Insertion
Chr 5: 119130981 - 119168491
Public Clones GC0967 (tigem)
Private Clones OST98611 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7258
Vector Insertion
Chr 5: 119209273 - 119211294
Public Clones RRT211 (baygenomics) RRT464 (baygenomics)
Private Clones OST410733 (lexicon)
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100816
Sequence
GCTCCGACATGCCCCGCTCTGGCGGCCGGGCTCGCGGAGGACCATGACCGCCGCGGCGAACTGGGTAGCGAACGGGGCGAGCCTGGAGGATTGTCACTCC

AACCTCTTCTCGCTG - UNI8731 - GCTGAACTCACAGGAATCAAATGGCGTAGGTACAATTTTGGAGGGCACGGGGACTGTGGACCCATAATTTCA

GCCCCAGCCCAAGATGATCCAATCCTGTTAAGTTTCATCCGCTGTCTGCAAGCCAACCTGCTGTGTGTATGGCGTCGTGATGTCAAGCCAGATTGCAAAG

AGCTCTGGATATTCTGGTGGGGAGATGAACCCAACCTAGTGGGAGTAATACATCATGAACTGCAGG - UNI6313 - TTGTGGAAGAAGGACTCTGGG

AAAATGGCCTTTCCTATGAATGTAGGACGCTGCTCTTCAAAGCAATCCACAATCTGTTAGAAAG GTGCCTAATGGATAAGAACTTCGTGCGGATCGGGA

AGTGGTTTGTGCGGCCCTATGACAAGGATGAAAAGCCAGTCAACAAAAG - UNI357 - TGAGCATCTTTCCTGTGCTTTCACATTCTTCCTTCATGG

AGAGAGTAACGTGTGCACAAGTGTGGAGATAGCTCAGCACCAGCCGATCTATTTGATCAACGAGGAACACTTACACATGGCCCAATCTTCACCTGCACCA

TTTCAAG TACTGGTGAGTCCTTACGGCTTAAATGGCACACTAACAGGGCATGCATACAAGATGTCTGACCCGGCCGCCCGCAAGCTGATTGAGGAATGG

CACTGTTTCTACCCGATGGTGCTGAGGAAGAGGGAGGAGCCTCGAGAAGAGGCTGAGCTGGGGTATGACGACGACTTCCCGGTGGCAGTTGAAGTCATTG

TTG GTGGCGTCCGGATGGTCTACCCTTCGGCTTTCGTGTTGGTCTCTCAGAATGACATCCCAGTTCCTCAGAGTGGGCACGGCACAGTTGCACAGCAGG

GGCTTGGTAGTGTGAAAGACCCCAGTAACTGTGGGATGCCTCTGACGCCTCCCACCTCCCCAGAGCAGGTGGTTATAG GAGAGAGCGGAGGTGTGCAGA

GTGCTGCCAGTCACCTCGGTTCCCAGGATGGAGGGATGTCAACTATGCACAGTCCGAAGAGATCAAGGAAGACCCCTCCTAAACTGCACAGTCACATGGT

CCGTCGAGTCTGGCGGGAGTGCATCCTCAGCCGAGCCCAGTCTAA GAGGAGCCAGATGTCGACGCCCACTCGGGAAGAAGAGGCTGCTCACAGTCCTGC

TGCCTGGGATTTTGTGGACCCAACCCAAAGAGTCAGCTGCTCCTGCTCCAG GCATAAACTGTTAAAACGGTGTGCAGTAGGACCCAGCCGACCTCCCGC

CATCTCTCAGCCAGGCTTCAGTGCAGGACTGCCATCATCTTCATCCTTACCACCCCCTGCTTCTTCCAAGCACAAAACCACAGAAAGACAAGAAAAAGGA

GACAAGTTGCAAAAGAGACCCTTGGTGCCCTTTCACCATAGGCCCTCTGTGGCCGAAGAATTATGCGTGGAGCAGGATGCGCCTGGGCAGAAGCTAGGGC

TGGCAGGGATAGACGCCTCCTTAGAGGTGTCGAACACTCGAAAGTATGATAAGCAAATGGCCGTGCCTTCCAGAAATACAAGCAAGCAAATGAATCTGAA

TCCTATGGATTCTCCTCATTCCCCCATCTCCCCTCTGCCCCCCACACTCAGCCCTCAGCCACGAGGTCAGGAGGCAGAGAGTTTGGACCCACCTTCTGTC

CCTGTGAACCCTGCCCTCTATGGAAATGGGCTAGACCTTCAGCAGCTGTCTACTATAGAGGACAGAACTGTCCTCGTAGGCCAAAGACTGCCTCTGATGG

CAGAGGCCAGTGAGACAGCCTTGTACAGTGGGCTCAGGCCTTCATACACCGAGTCGTCAGACAGGTGGTGGCAGAGTTTTCGTCTCCCATCCAGTGAGGA

TGCTGAGTTCCGGCCTCCAGAGCTGCAGGGGGAGAGGTTTGACACTGCCCTGGACCTGAATCCCGAGAGCACGGCCCTGCAAAG ACTCTTAGCACAACC

TAACAAGCGGTTCAAAATCTGGCAGGATGAGCAGCCTCAGGTGCAGCCTCTCCCCTTCCTCGACCCATCACCTCTGTCCCAGCAGCCTGGAGACACTCTG

GGAGAAGTCAACGACCCATACACCTTTGAGGATGGCGACATAAAGTACATCTTCACAGCAAATAAGAAATGCAAGCAGGGGACGGAGAAGGACTCCCTGA

AAAAGAACAAG TCAGAGGATGGATTTGGTACCAAGGATGTCACTACACCAGGTCATTCCACGCCGGTGCCTGATGGGAAAAATGCCATGTCTATTTTCA

GTTCTGCTACTAAAACAG ATGTCCGGCAGGACAGCGCTGCTGGCAGAGCCGGCTCTGGGAGCCTTACCCAGGTGACAGATTTGGCACCTTCCCTGCACG

ACTTAGACAACATCTTTGATAACTCTGATGAAGACGAGCTTGGG GCCGTGTCCCCTGCTCTACGTTCATCCAAGATGCCTACTGTTGGGACTGAGGAGC

GGCCCCCTGGGAAGGACGGAAGAGCTGCTGGCCCTTACCCTCCAA CAGTTGCAGACTTGCAAAGGATGTTCCCCACCCCTCCGTCATTGGAACAGCACC

CTGCATTTTCTCCTGTGATGAACTATAAAGATGGAGTAAGTTCAGAGACAGTGACTGCACTGGGCATGATGGAGAGTCCCGTGGTCAGCATGGTCCCCAC

ACACCTCACGGAGTTTAGGATGGAAGTGGAAGATGGCTTAGGAAGCCCCAAGCCAGAGGAGATAAAG GACTTTTCCTATGTGCACAAAGTGCCGCAGTT

CCAGCCTTTCGTGGGATCCTCCATGTTTGCTCCACTGAAGACGCTGCCGAGCCATTGCCTGCTGCCTCTGAAGACACCTGACGCCTGTCTGTTCCGGCCC

TCATGGGCGGTCCCTCCTAAGATGGAACAGCTGCCCATGCCCCCTGCAGCCTCTTCTATTAGAGACGGCTACAA TAACGTGCCTAGTGTCGGGAGCCTT

GCAGACCCAGACTATCTGAACACACCACAGATGAACACACCTGTGACACTCAACAGCGCCGCCCCTGCCAGCAACAGTGGAGCTGGAGTTCTCCCATCTC

CAGCTACCCCTCGGTTCTCTGTCCCCACACCACGAACCCCCAGGACTCCAAGAACTCCCAGAGGTGGGGGCACTGCTAGTGGCCAAGGGTCTGTGAAATA

TGACAGCACAGATCAGGGGTCACCAGCTTCCACCCCCTCTACCACAAGGCCCCTTAACTCTGTGGAGCCTGCCACCATGCAGCCAATTCCTGAGGCCCAC

AGTCTCTATGTCACCCTCATTCTGTCAGATTCTGTGATGAATGTCTTCAAGGACAGGAACTTTGACAGCTGTTGCATTTGTGCCTGCAACATGAACATCA

AAGGGGCAGATGTCGGGCTGTACATCCCCGATTCCTCCAAGGAGGACCAGTACCGCTGCACCTGTGGGTTTAGTGCGATCGTGAACCGTAAACTTGGCTA

CAACTCGGGGCTCTTCCTCGAAGATGAGCTGGATATTTTTGGCAAGAATTCTGACATCGGCCAAGCTGCAGAAAGACGCCTGATGATGTGCCAGTCCTCC

GGCCAGTCCACCTTGCTTCCTCAGGTGGAGGGTGCCCGGAAAGCCCCAGAGCCCCCCGTAAGCCTCCTCCTCCTCCTTCAGAATCAGCACACGCAGCCCT

TCGCTTCTCTCAGCTTCCTGGATTACATCTCCTCCGCCAATCGCCATGCACTCCCCTGTGTGAGCTGGACTTATGACCGTGTGCAGGCAGATAACAATGA

TTACTGGACAGAGTGCTTCAACGCATTGGAACAGGGGAGGCAATATGTGGATAATCCCACAGGCGGGAAAGTGGACGAGGCTCTGGTGAGAAGTGCCACC

GTACATTGTTGGCCGCACAGCAACG TGCTGGACACAAGCATGCTCTCATCCCAAGATGTGGTGCGCATGCTGCTGTCCCTGCAGCCCTTCCTGCAGGAT

GCCATCCAGAAGAAGCGCACGGGCAGGACCTGGGAGAACATCCAGCATGTGCAGGGGCCGCTCACCTGGCAGCAGTTCCATAAGATGGCGGGGCGCGGGA

CCTACG GTTCCGAAGAGTCTCCTGAGCCGCTGCCCATCCCCACTCTGCTGGTGGGCTACGACAAGGAGTTCTTGACCATCTCGCCCTTCTCCTTGCCCT

TCTGGGAGAGGCTGCTCTTGGAGCCCTATGGGGGCCACCGTGATGTTGCTTATATTGTGGTGTGTCCAGAAAATGAGGCCTTGCTCGAAGGAGCCAAAAC

TTTCTTCAGGGACTTGAGTGCTGTATATGAG ATGTGTCGGCTGGGACAGCACAAGCCCATCTGCAAAGTGCTCCGTGATGGGATCATGCGTGTGGGCAA

GACCGTGGCGCAGAAGCTGACAGAGGAGCTTGTGAGCGAGTGGTTTAACCAGCCATGGAGCAGTGAGGAGAGTGACAATCATTCCAGACTCAAACTTTAT

GCTCAAGTTTGCCGCCATCACCTAG CACCTTATTTAGCCACTCTGCAGCTCGACAGTGGCCTGCTGATGCCACCTAAGCACCAGAGCCCACCAGCAGAA

GCACAGGGACAAGCCACGCCTGGGAATGCTGGGTCTTTACCTTCGAATTCAGGCTCAGGAGCACCTCCAGCTGGCAGTGCATTCAATCCCACCTCCAGCA

GCTCTGCAAACCCCACAACAAGTAGTTCATCTGCCTCCTCTGGGCCGCCAGGCTCCTCAGCTGCCTCTGCTCCAGGCATCACTCAGATGAACACTACCTC

TTCTTCAGGATTCGGTGGTGGTGTTGGAGGGCAGAACCCCAGTGCGGGGGGCAGCTCTACAGATCGAACCCCAGGGAATGTGGCTTGTGGAGACACTGAG

CCTGGGCAGAGCTGCACCCAGTCCTCACAGGATGGACAAGACAG TGTTACAGAGAGGGAGAGAATAGGAATCCCCACGGAGCCTGACTCTGCAGACAGC

CATGCCTACCCTCCAGCCGTCGTCATTTACATGGTGGACCCCTTCACCTACACTGCGGAGGAGGACTCCAGCTCTGGAAACTTCTGGCTGCTGAGCTTGA

TGCGCTGCTACACGGAGATGCTGGATCACTTACCCGAGCACATGAGAAGCTCGTTCATTCTCCAG ATTGTGCCTTGCCAGTACATGCTGCAGACCATGA

AGGATGAGCATGTCTTCTACATTCAATACTTGAAGTCCATGGCGTTCTCAGTGTACTGCCAGTGCAGGCGGCCTCTGCCTACACAGATCCACATTAAATC

CCTCACAGGCTTCGGGCCTGCAGCCAGCATTGAGATGACCCTCAAGAACCCGGAG CGGCCCAGTCCAATCCAGCTTTATTCCCCTCCCTTTATATTGGC

TCCAATCAAAGACAAGCAGACAGAACCGGGAGAGACCTTTGGTGAGGCGAGCCAGAAATACAATGTGCTCTTTGTGGGCTATTGTCTGTCTCATGACCAG

CGCTGGCTCTTGGCATCCTGCACTGACCTGCATGGGGAGTTACTGGAGACCTGTGTTGTAAACATTGCTTTACCGAGCAG GACCCTTCATGTTCCTCTG

TCTGTCAGGTCACGGAAGAGTAAAGTGTCTGCACGGAAGGTCGGGCTGCAGAAGCTGTGGGAGTGGTGCCTGGGCATTGTCCAGATGACTTCTCTGCCCT

GGAGAGTTGTCATTGGCCGCTTGGGGCGTCTTGGCCACGGGGAGCTGAAAG ATTGGAGTATCCTCCTTGGAGAATGTTCACTGCAGACAATCAGCAAAC

AGCTCAAGGATGTGTGCCGAATGTGTGGGATCTCTGCTGCAGACTCTCCTTCCATCCTCAGTGCCTGCTTGGTTGCCATGGAGCCCCAGGGGTCCTTTGT

AGTGATGCCAG ATGCTGTCACAATGGGCTCTGTGTTTGGCCGAAGCACTGCATTGAATATGCAGTCGTCCCAGCTGAACACACCTCAGGACGCCTCCTG

CACCCACATCTTGGTGTTCCCGACATCATCAACCATCCAGGTGGCTCCAGCCAACTACCCCAATGAGGATGGGTTTAGCCCCAACAATG ATGACATGTT

TGTAGACCTTCCATTCCCAGACGACATGGACAATGACATTGGCATCCTCATGACCGGGAACCTCCACTCCTCTCCCAACTCCTCTCCGGTTCCCTCCCCG

GGCTCTCCCTCTGGAATCGGTGTGGGCTCTCACTTCCAGCACAGTCGG AGCCAGGGAGAGCGGCTTCTGTCTCGGGAGGCTCCAGAGGAACTCAAGCAG

CAGCCCCTGGCCCTTGGGTATTTTGTGTCCACTGCCAAAGCGGAGAACCTCCCGCAGTGGTTTTGGTCATCGTGCCCCCAGGCCCGGAACCAGTGCCCAC

TCTTCCTGAAG - UNI7258 - GCTTCCCTGCATCACCACATCTCTGTAGCGCAGACCGATGAGCTCCTTCCTGCCAGGACCTCTCAGCGGGCTCCAC

ACCCTCTGGACTCCAAGACCACATCTGACGTTCTAAG GTTTGTGCTGGAGCAGTACAACGCCCTATCCTGGCTCACGTGCAATCCAGCCACCCAGGACC

GCACTTCCTGCCTTCCCGTCCACTTCGTGGTGCTCACGCAGCTGTACAATGCCATCATGAACATGCTCTAACCGGGAAGGGAAGCGCTTGCCCTCTGCCT

CAGCTCCTCCTGCAGCCTTGGCCAGGGAGCCTGCTCCACTCTGCAAATGCCCGGCCTTTTTTAGAGCACTCCCTATACCCCGCACTGTGACGCCTTCTGA

GCAGGCTCATGCTCCTCC
Translation
 - UNI8731 -  - UNI6313 -   - UNI357 -   MPLTPPTSPEQVVIG GESGGVQSAASHLGSQDGGMSTMHSPKRSRKTPPKLHSHMVRR

VWRECILSRAQSK KRSQMSTPTREEEAAHSPAAWDFVDPTQRVSCSCSR RHKLLKRCAVGPSRPPAISQPGFSAGLPSSSSLPPPASSKHKTTERQEK

GDKLQKRPLVPFHHRPSVAEELCVEQDAPGQKLGLAGIDASLEVSNTRKYDKQMAVPSRNTSKQMNLNPMDSPHSPISPLPPTLSPQPRGQEAESLDPPS

VPVNPALYGNGLDLQQLSTIEDRTVLVGQRLPLMAEASETALYSGLRPSYTESSDRWWQSFRLPSSEDAEFRPPELQGERFDTALDLNPESTALQR RLL

AQPNKRFKIWQDEQPQVQPLPFLDPSPLSQQPGDTLGEVNDPYTFEDGDIKYIFTANKKCKQGTEKDSLKKNK SEDGFGTKDVTTPGHSTPVPDGKNAM

SIFSSATKTD DVRQDSAAGRAGSGSLTQVTDLAPSLHDLDNIFDNSDEDELG AVSPALRSSKMPTVGTEERPPGKDGRAAGPYPPT TVADLQRMFPT

PPSLEQHPAFSPVMNYKDGVSSETVTALGMMESPVVSMVPTHLTEFRMEVEDGLGSPKPEEIK DFSYVHKVPQFQPFVGSSMFAPLKTLPSHCLLPLKT

PDACLFRPSWAVPPKMEQLPMPPAASSIRDGYN NNVPSVGSLADPDYLNTPQMNTPVTLNSAAPASNSGAGVLPSPATPRFSVPTPRTPRTPRTPRGGG

TASGQGSVKYDSTDQGSPASTPSTTRPLNSVEPATMQPIPEAHSLYVTLILSDSVMNVFKDRNFDSCCICACNMNIKGADVGLYIPDSSKEDQYRCTCGF

SAIVNRKLGYNSGLFLEDELDIFGKNSDIGQAAERRLMMCQSSGQSTLLPQVEGARKAPEPPVSLLLLLQNQHTQPFASLSFLDYISSANRHALPCVSWT

YDRVQADNNDYWTECFNALEQGRQYVDNPTGGKVDEALVRSATVHCWPHSNV VLDTSMLSSQDVVRMLLSLQPFLQDAIQKKRTGRTWENIQHVQGPLT

WQQFHKMAGRGTYG GSEESPEPLPIPTLLVGYDKEFLTISPFSLPFWERLLLEPYGGHRDVAYIVVCPENEALLEGAKTFFRDLSAVYE MCRLGQHKP

ICKVLRDGIMRVGKTVAQKLTEELVSEWFNQPWSSEESDNHSRLKLYAQVCRHHLA APYLATLQLDSGLLMPPKHQSPPAEAQGQATPGNAGSLPSNSG

SGAPPAGSAFNPTSSSSANPTTSSSSASSGPPGSSAASAPGITQMNTTSSSGFGGGVGGQNPSAGGSSTDRTPGNVACGDTEPGQSCTQSSQDGQDS SV

TERERIGIPTEPDSADSHAYPPAVVIYMVDPFTYTAEEDSSSGNFWLLSLMRCYTEMLDHLPEHMRSSFILQ IVPCQYMLQTMKDEHVFYIQYLKSMAF

SVYCQCRRPLPTQIHIKSLTGFGPAASIEMTLKNPE RPSPIQLYSPPFILAPIKDKQTEPGETFGEASQKYNVLFVGYCLSHDQRWLLASCTDLHGELL

ETCVVNIALPSR RTLHVPLSVRSRKSKVSARKVGLQKLWEWCLGIVQMTSLPWRVVIGRLGRLGHGELKD DWSILLGECSLQTISKQLKDVCRMCGIS

AADSPSILSACLVAMEPQGSFVVMPD DAVTMGSVFGRSTALNMQSSQLNTPQDASCTHILVFPTSSTIQVAPANYPNEDGFSPNND DDMFVDLPFPDD

MDNDIGILMTGNLHSSPNSSPVPSPGSPSGIGVGSHFQHSR SQGERLLSREAPEELKQQPLALGYFVSTAKAENLPQWFWSSCPQARNQCPLFLK - U

NI7258 - ASLHHHISVAQTDELLPARTSQRAPHPLDSKTTSDVLR RFVLEQYNALSWLTCNPATQDRTSCLPVHFVVLTQLYNAIMNML

For any suggestions or comments, please send an email to unitrap@crg.es