Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000018160 (Med1)
Chromosomal location
Chr 11: 98014028 - 98054607 (-)
Description
methyl-CpG binding domain protein 4 Gene [Source:MGI (curated);Acc:Med1-004]
RefSeq_dna
NM_001080118 NM_013634 
RefSeq_peptide
NP_598788.2 NP_001073587.1 NP_038662.2 
UniGene
Mm.12926 Mm.470405 
MGI
MGI:1100846 
Uniprot/SWISSPROT
Q925J9 
Uniprot/SPTREMBL
B1AQH6 
Human Ortholog
ENSG00000125686 (PPARBP)
Omim not available
UniTrap UNI5529
Vector Insertion
Chr 11: 98054372 - 98054608
Public Clones RRE282 (baygenomics) YTA158 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22196
Vector Insertion
Chr 11: 98050603 - 98054120
Public Clones (sanger) D162E07 (ggtc)
Private Clones OST303631 (lexicon) OST290082 (lexicon) OST200019 (lexicon) OST145741 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14342
Vector Insertion
Chr 11: 98050495 - 98054221
Public Clones FHCRC-GT-S18-2A1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5763
Vector Insertion
Chr 11: 98045235 - 98050495
Public Clones CSI154 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23316
Vector Insertion
Chr 11: 98045235 - 98050495
Public Clones not available
Private Clones OST265104 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5583
Vector Insertion
Chr 11: 98041623 - 98045155
Public Clones CSI153 (baygenomics) YTA259 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23613
Vector Insertion
Chr 11: 98041464 - 98041567
Public Clones not available
Private Clones OST251684 (lexicon) OST128615 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7049
Vector Insertion
Chr 11: 98033085 - 98034534
Public Clones RRY061 (baygenomics)
Private Clones OST423084 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9218
Vector Insertion
Chr 11: 98027689 - 98028012
Public Clones RRC164 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19273
Vector Insertion
Chr 11: 98016554 - 98019784
Public Clones not available
Private Clones OST397654 (lexicon)
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000092735
Sequence
GATCTTTGGGAAGTTCCGTTGGGGAAGATGGCGGCGGCCGCGAGCACCCTTCTCTTCTTGCCGCCGGGGACTTCAGACTGAGCCTTCCCCGGAAGAGTCG

GGGCCGCTGGTGCGCCGCTTCCCCGGAGCCCAGGCTAACTTGGTTCCCCTCTGAGTGGCGGGGAAAGGCTCCCCGGCTCGTGGCGGACCCAAGACCTCCC

CGCTGTCAGGATGAAGGCTCAGGGGGAAACCGAGG - UNI5529 - - UNI14342 - - UNI22196 - ACTCAGAGAGGCTGAGTAAGATGAGC

TCCCTCCTGGAACGGCTCCATGCAAAATTTAACCAGAACAGACCTTGGAGTGAAACCATTAAGCTTGTGCGTCAAGTAATG - UNI5763 - - UNI1

4342 - - UNI23316 - GAGAAGAGGGTCGTAATGAGTTCTGGAGGGCATCAGCATTTGGTCAGCTGTTTGGAGACATTGCAGAAGGCTCTCAAAG 

- UNI5583 - TAACATCTTTGCCAGCAATGACTGATCGTTTGGAATCTATAGCCAGACAGAATGG - UNI23613 - ACTGGGCTCTCACCTCAGT

GCCAGTGGCACTGAGTGTTACATCACGTCAGATATGTTCTATGTGGAAGTGCAGTTAGATCCTGCAGGACAGCTTTGTGATGTCAAAGTGGCTCACCATG

GGGAGAATCCTGTG AGCTGTCCAGAGCTTGTACAGCAGTTAAG GGAAAAGAATTTTGAGGAATTTTCCAAGCATCTTAAGGGTCTTGTTAATCTGTAT

AATCTCCCAGGGGACAA - UNI7049 - CAAACTGAAGACTAAAATGTATCTGGCTCTCCAATCCTTAGAACAGGACCTTTCTAAAATGGCTATTATG

TACTG GAAGGCAACCAACGCCGCTCCCTTGGATAAGATTCTTCATGGAAGTGTTGGTTATCTCACCCCGCGGAGTGGGG GTCATTTAATGAATATGAA

ATACTATGCCTCTCCATCTGACCTGCTGGATGATAAGACTGCCTCTCCTATCATTTTGCATGAAAAGAATG TTCCTCGGTCTTTGGGAATGAATGCCTC

AGTGACAATTGAAGGAACCTCTGCTATGTACAAACTCCCAATTGCCCCATTAATTATGGGGTCACACCCAGCTGACAACAAATG GACCCCTTCTTTCTC

CGCAGTCACTAGTGCCAACAGTGTTGATCTTCCTGCGTGTTTCTTCTTGAAATTTCCCCAGCCAATTCCAGTATCTAAAGCATTTGTTCAGAAACTGCAA

AATTGCACAG - UNI9218 - GAATCCCGTTGTTTGAGACTCCGCCCACTTACCTGCCCCTGTATGAACTCATCACTCAGTTTGAGCTGTCAAAGGAT

CCTGACCCTTTACCTTTGAATCACAACATGCGATTTTACGCT GCTCTTCCAGGTCAGCAGCACTGCTATTTTCTCAATAAAGATGCTCCTCTTCCTGAT

GGTCAGAGCCTGCAGGGAACACTGGTCAGCAAAATCACCTTCCAGCACCCTGGCCGAGTTCCTCTTATCTTGAATATGATCAGACACCAAGTGGCCTATA

ACACTCTAATTGGAAGCTGTGTCAAAAGAACTATTTTAAAAGAAG ATTCTCCTGGGCTCCTCCAGTTTGAAGTGTGTCCTCTCTCAGAATCTCGCTTCA

GTGTATCTTTTCAGCACCCTGTGAATGACTCCCTTGTGTGTG TGGTGATGGATGTGCAAGACTCAACACATGTGAGCTGTAAACTCTACAAGGGGCTGT

CAGATGCACTAATCTGTACAGACGACTTCATTGCCAAAGTTGTTCAAAG - UNI19273 - ATGTATGTCCATTCCTGTGACGATGAGGGCTATTCGG

AGGAAGGCTGAAACCATACAGGCTGACACCCCAGCACTGTCTCTCATTGCAGAGACAGTTGAAGACATGGTGAAAAAGAACCTGCCCCCGGCTAGCAGCC

CAGG - UNI19273 - GGTGGAGGAGAAGCGGCAGGATAAACCAAGCCTGGGACACCTCCCTCCCATCCAGGTGTGCTCACCCTCCTGTTTGAAAGAC

GGCAAGGACATGAAGTCAACGTGTACCTATTTGCTGCTGCTGCTGCTGCTGGAGTTTATGGTTTTTTTTTTCTTTTTTTTGACCTATTCTTCTGTCTTTG

GGCTTCATGTTAAGGGTCTTTGGACAAAAATCTGCTCTGATGTACAAGAATATTTCAGTGTATCTTAA
Translation
MKAQGETED - UNI5529 - - UNI14342 - - UNI22196 - DSERLSKMSSLLERLHAKFNQNRPWSETIKLVRQVM - UNI5763 - - U

NI14342 - - UNI23316 - EKRVVMSSGGHQHLVSCLETLQKALKV - UNI5583 - VTSLPAMTDRLESIARQNG - UNI23613 - GLGS

HLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPV SCPELVQQLR REKNFEEFSKHLKGLVNLYNLPGDN - UNI7049 - NKLKTKMYL

ALQSLEQDLSKMAIMYW WKATNAAPLDKILHGSVGYLTPRSGG GHLMNMKYYASPSDLLDDKTASPIILHEKNV VPRSLGMNASVTIEGTSAMYKLP

IAPLIMGSHPADNKW WTPSFSAVTSANSVDLPACFFLKFPQPIPVSKAFVQKLQNCTG - UNI9218 - GIPLFETPPTYLPLYELITQFELSKDPD

PLPLNHNMRFYA ALPGQQHCYFLNKDAPLPDGQSLQGTLVSKITFQHPGRVPLILNMIRHQVAYNTLIGSCVKRTILKED DSPGLLQFEVCPLSESRF

SVSFQHPVNDSLVCV VVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQR - UNI19273 - RCMSIPVTMRAIRRKAETIQADTPALSLIAETVE

DMVKKNLPPASSPG - UNI19273 - GVEEKRQDKPSLGHLPPIQVCSPSCLKDGKDMKSTCTYLLLLLLLEFMVFFFFFLTYSSVFGLHVKGLWTKI

CSDVQEYFSVS
Transcript ENSMUST00000107545
Sequence
GATCTTTGGGAAGTTCCGTTGGGGAAGATGGCGGCGGCCGCGAGCACCCTTCTCTTCTTGCCGCCGGGGACTTCAGACTGAGCCTTCCCCGGAAGAGTCG

GGGCCGCTGGTGCGCCGCTTCCCCGGAGCCCAGGCTAACTTGGTTCCCCTCTGAGTGGCGGGGAAAGGCTCCCCGGCTCGTGGCGGACCCAAGACCTCCC

CGCTGTCAGGATGAAGGCTCAGGGGGAAACCGAGG - UNI5529 - - UNI14342 - - UNI22196 - ACTCAGAGAGGCTGAGTAAGATGAGC

TCCCTCCTGGAACGGCTCCATGCAAAATTTAACCAGAACAGACCTTGGAGTGAAACCATTAAGCTTGTGCGTCAAGTAATG - UNI5763 - - UNI1

4342 - - UNI23316 - GAGAAGAGGGTCGTAATGAGTTCTGGAGGGCATCAGCATTTGGTCAGCTGTTTGGAGACATTGCAGAAGGCTCTCAAAG 

- UNI5583 - TAACATCTTTGCCAGCAATGACTGATCGTTTGGAATCTATAGCCAGACAGAATGG - UNI23613 - ACTGGGCTCTCACCTCAGT

GCCAGTGGCACTGAGTGTTACATCACGTCAGATATGTTCTATGTGGAAGTGCAGTTAGATCCTGCAGGACAGCTTTGTGATGTCAAAGTGGCTCACCATG

GGGAGAATCCTGTG AGCTGTCCAGAGCTTGTACAGCAGTTAAG GGAAAAGAATTTTGAGGAATTTTCCAAGCATCTTAAGGGTCTTGTTAATCTGTAT

AATCTCCCAGGGGACAA - UNI7049 - CAAACTGAAGACTAAAATGTATCTGGCTCTCCAATCCTTAGAACAGGACCTTTCTAAAATGGCTATTATG

TACTG GAAGGCAACCAACGCCGCTCCCTTGGATAAGATTCTTCATGGAAGTGTTGGTTATCTCACCCCGCGGAGTGGGG GTCATTTAATGAATATGAA

ATACTATGCCTCTCCATCTGACCTGCTGGATGATAAGACTGCCTCTCCTATCATTTTGCATGAAAAGAATG TTCCTCGGTCTTTGGGAATGAATGCCTC

AGTGACAATTGAAGGAACCTCTGCTATGTACAAACTCCCAATTGCCCCATTAATTATGGGGTCACACCCAGCTGACAACAAATG GACCCCTTCTTTCTC

CGCAGTCACTAGTGCCAACAGTGTTGATCTTCCTGCGTGTTTCTTCTTGAAATTTCCCCAGCCAATTCCAGTATCTAAAGCATTTGTTCAGAAACTGCAA

AATTGCACAG - UNI9218 - GAATCCCGTTGTTTGAGACTCCGCCCACTTACCTGCCCCTGTATGAACTCATCACTCAGTTTGAGCTGTCAAAGGAT

CCTGACCCTTTACCTTTGAATCACAACATGCGATTTTACGCT GCTCTTCCAGGTCAGCAGCACTGCTATTTTCTCAATAAAGATGCTCCTCTTCCTGAT

GGTCAGAGCCTGCAGGGAACACTGGTCAGCAAAATCACCTTCCAGCACCCTGGCCGAGTTCCTCTTATCTTGAATATGATCAGACACCAAGTGGCCTATA

ACACTCTAATTGGAAGCTGTGTCAAAAGAACTATTTTAAAAGAAG ATTCTCCTGGGCTCCTCCAGTTTGAAGTGTGTCCTCTCTCAGAATCTCGCTTCA

GTGTATCTTTTCAGCACCCTGTGAATGACTCCCTTGTGTGTG TGGTGATGGATGTGCAAGACTCAACACATGTGAGCTGTAAACTCTACAAGGGGCTGT

CAGATGCACTAATCTGTACAGACGACTTCATTGCCAAAGTTGTTCAAAG - UNI19273 - ATGTATGTCCATTCCTGTGACGATGAGGGCTATTCGG

AGGAAGGCTGAAACCATACAGGCTGACACCCCAGCACTGTCTCTCATTGCAGAGACAGTTGAAGACATGGTGAAAAAGAACCTGCCCCCGGCTAGCAGCC

CAGGGTATGGCATGACCACAGGCAACAACCCAATGAGTGGTACCACTACACCAACCAACACCTTTCCGGGGGGTCCCATTACCACCTTGTTTAATATGAG

CATGAGCATCAAAGATCGGCATGAGTCGGTGGGCCATGGGGAGGACTTCAGCAAGGTGTCTCAGAACCCAATTCTTACCAGTTTGTTGCAAATCACAGGG

AACGGGGGGTCTACCATTGGCTCGAGTCCGACCCCTCCTCATCACACGCCGCCACCTGTCTCTTCGATGGCCGGCAACACCAAGAACCACCCGATGCTCA

TGAACCTTCTTAAAGATAACCCTGCCCAGGATTTCTCAACCCTTTATGGAAGCAGCCCTTTAGAAAGGCAGAACTCCTCTTCCGGATCACCCCGGATGGA

AATGTGCTCGGGGAGCAACAAGGCCAAGAAGAAGAAGTCGTCAAGAGTCCCACCTGACAAACCCAAGCACCAGACTGAAGACGATTTCCAGAGGGAGCTC

TTTTCCATGGATGTCGACTCACAGAACCCTATGTTTGACGTCAGCATGACCGCTGACGCGCTGGATACACCTCATATCACCCCAGCTCCAAGCCAGTGTA

GCACTCCCCCAGCAACGTACCCACAGCCAGTGTCTCACCCCCAGCCCAGTATTCAGAGGATGGTCCGACTGTCCAGTTCAGACAGCATTGGCCCAGATGT

AACTGATATTCTTTCAGATATTGCCGAAGAAGCTTCAAAGCTTCCCAGCACGAGTGATGACTGCCCACCAATTGGCACCCCTGTTCGAGATTCCTCAAGT

TCTGGGCATTCTCAGAGTGCCCTCTTTGATTCTGATGTCTTTCAAACTAATAATAATGAAAATCCATACACTGATCCAGCTGACCTTATTGCAGATGCTG

CTGGAAGCCCCAATAGTGATTCTCCTACCAATCATTTTTTCCCTGATGGAGTAGATTTCAATCCTGATTTGTTGAACAGCCAAAGCCAAAGTGGTTTTGG

AGAGGAGTATTTTGATGAAAGTAGTCAGAGTGGGGATAATGATGATTTCAAAGGATTTGCATCTCAGGCATTAAATACATTGGGGATGCCAATGCTTGGA

GGTGACAATGGGGAGCCAAAATTTAAGGGCAGCAGCCAGGCTGACACGGTGGACTTCAGTATTATATCAGTAGCCGGTAAGGCTTTGGGTGCTGCAGATC

TGATGGAGCACCACAGTGGGAGTCAGAGTCCTTTACTGACCACTGGAGAATTAGGGAAAGAAAAAACTCAAAAGAGGGTGAAGGAAGGCAACGGCACAGG

TGCTAGCAGTGGATCAGGTCCAGGGTCAGACAGCAAGCCAGGCAAGCGCAGCCGCACTCCCTCCAATGATGGGAAGAGCAAGGATAAGCCTCCAAAGCGG

AAGAAGGCAGACACTGAGGGGAAGTCCCCATCTCACAGTTCTTCTAATAGACCTTTCACCCCACCTACCAGCACGGGTGGGTCCAAATCCCCAGGCAGTT

CAGGACGATCTCAGACGCCCCCAGGTGTTGCCACCCCGCCCATTCCCAAGATTACCATTCAGATTCCTAAAGGGACAGTGATGGTGGGCAAGCCCTCCTC

TCACAGTCAGTACACTAGCAGTGGTTCTGTGTCTTCCTCTGGCAGCAAAAGCCACCATAGTCATTCTTCCTCCTCCTCTTCCTTAGCTTCTGCTTCCACC

TCAGGCAAGGTGAAAAGCAGTAAATCTGAAGGCTCATCAAGTTCCAAGCTCAGTGGCAGTATGTATGCTAGCCAAGGGTCTTCTGGATCCAGCCAGTCCA

AAAATTCATCTCAGACTGGGGGGAAGCCAGGCTCCTCTCCCATTACCAAACATGGACTGAGCAGTGGGTCCAGCAGTACCAAGATGAAACCTCAAGGCAA

GCCATCCTCCCTTATGAACCCTTCTATAAGTAAGCCAAACATATCCCCTTCCCATTCAAGGCCTCCCGGAGGCTCAGATAAGCTTGCCTCTCCAATGAAG

CCTGTTCCTGGAACCCCCCCATCCTCTAAAGCCAAGTCCCCTATCAGTTCAGGTTCCAGTGGTTCTCATGTGTCAGGAACTAGTTCAAGCTCTGGTATGA

AGTCATCTTCAGGGTCAGCATCCTCAGGCTCAGTGTCTCAAAAAACCCCTCCAGCATCTAATTCTTGTACACCATCTTCCTCTTCGTTTTCCTCAAGTGG

TTCTTCCATGTCATCCTCTCAGAATCAACATGGCAGTTCCAAAGGGAAATCTCCCAGTAGGAATAAGAAGCCTTCCTTGACAGCTGTCATAGATAAATTG

AAGCATGGGGTGGTTACCAGTGGGCCTGGGGGTGAGGATCCAATAGACAGTCAGATGGGCGCAAGCACAAATTCTTCTAACCATCCCATGTCCTCCAAAC

ATAACACGTCAGGAGGGGAGTTCCAGAGCAAACGTGAGAAAAGTGATAAAGACAAATCCAAGGTCTCTGCTTCTGGGGGGTCAGTGGATTCCTCTAAGAA

GACTTCAGAGTCAAAAAATGTGGGGAGCACGGGGGTGGCAAAAATCATTATCAGCAAGCACGACGGAGGCTCCCCGAGCATCAAAGCCAAAGTGACGCTA

CAGAAACCTGGAGAAAGTGGTGGAGATGGGCTCAGGCCACAGATAGCCTCATCAAAGAACTATGGCTCTCCACTTATCAGTGGTTCCACTCCAAAGCACG

AACGGGGTTCTCCCAGCCACAGTAAGTCGCCAGCATATACACCACAGAATGTGGACAGTGAAAGTGAGTCAGGCTCCTCCATAGCAGAGAGATCCTACCA

GAACAGTCCCAGCTCAGAGGATGGTATCCGACCACTTCCAGAGTACAGCACTGAGAAGCATAAGAAGCACAAAAAGGAAAAGAAGAAAGTCAGAGACAAA

GACAGAGACAAGAAGAAGTCTCACAGCATGAAGCCAGAGAACTGGTCGAAATCCCCCATTTCTTCAGATCCGACGGCGTCTGTGACAAATAACCCTATCT

TATCTGCAGACAGGCCTTCTAGGCTCAGCCCTGACTTCATGATTGGGGAGGAAGATGATGATCTCATGGATGTGGCCCTGATTGGCAATTAGCCTAACTT

TCTAAACAGACACGTCCAGAGGAGAAACTAATGATATATGTAAACCAACCCGAGGGGTGAGTCAGACAGGCCCTGTCAGTGCTTAAGAGCCCTAAAGGGC

ATGGCCTCTACACCAAGCTGGGTACATTTATAAACATACATCTAGACCCTGCTGCCGAAACCATGTGGTTGGTTGTTCAGAAACAAGTCATATTTCTTTG

CCAGAAAGCAATGAATAAATTACTTGCTTAAGGGGAGAGGGGTGGTGGGAGAGGGTGTAGAGAGGGAGGGGTGGGAAATTGTTGTGGGAAATATTCATAT

ATTTTTCTCCCTTTTTCCATTTTCAGGACATGCTTTAAACTCATTTTAGTGCATGTATTTGAAGGGCTGGGCAGAAAATGAAAAAGCAATACATTCCTTG

ATGCATTCGCATGAAGGTTGCTCACCTGTGGGAGATGCCCATTGGAAGCATGGGCACGGGAAGGACTTTGACAGTTCTGGACACTGAAAGCAATGTTTGG

TGTCTGTTTCTTAGGAGTGATGGGGGAGGGAAAATTATTTTAGTTATTTATTTGTAATATTTTAATCCTTGATGTTTGTTTTTATGCAATGTTTGTTCCT

AAATCTATGAAGGTTATGGTTCAGAACAGTAGGAGGCAGGTAGCAAGGCTCGCCTGGTGGGGAGCTCGCAGCCTGTGCTGACGCTGCAGCACCAGTCCCA

CAGAGCTAATCACAGCCTGTCTTTGGAGTTGAATAGAAAAACCAAAACTATTATCTTTGGAGGTTTTTCACAGGGTTCAGACACCATAGGAATATTAGGA

GTGAGTTACCTCCCTATGCAGATAAAAGATTTATCTTCTTTCATTAAAAAGGAAGGGTGGCTTTGGGGGGTATACATTTGTTTTCAGAGTCTATACCCTA

TCGTATAAAAATCAGTATAGAATTAATAGTTCTCCTACTTCCACAATGTGCCAAAAGTCTACATCCCAGCATTTTGTTTGCAGGAGAGCTGATGCCATTC

CTAAGAGCTGGACTCTTTGTTTCTCTTCATCACAAGAAGAAGGAGTTCAGACTTAAATCACTCCACTGTATGCTCCCCGAGATAAACAGTTAAAAAAAAA

AAAAGCAGCCATAGTTCACTTAAAACAATTTCAAGCTCACTTGAAGTGATTAGGGCCTGGAATGCTAAGTGAGCATGAAGATAACCCTTGCTACCGTGTA

GCACACAGTCGGACCTTTTTGGAGAAACAGGTCTGAGTCTGGATTCTGAGGGACATCAAAGGAAGACCTCATAAATAGAGAAATGCAGGAGACCGTTTTG

AGTGCAACAGAAGTTCTCAGTATTTGGAGGGTCCTCTCAAAAGTCCGCGGCCTTACTTTGATTTCACCACCTGCACTGTGCCATTCCTGATGATTCCGTT

TGGGATCTGTATCAGCGGGGTGGGGGTGGGGCGTGATCCCCAGCACAACTCTTCTGGATTACAAAACAAGCAAAAGCCAGGTGATTCATGTTTGTGTGTG

TTATAAGTGGAGTGACTTCATCAGATACGGACGATTTCTACATCCAACACTGCAGGTTGTTGGAGTTAGCAT
Translation
MKAQGETED - UNI5529 - - UNI14342 - - UNI22196 - DSERLSKMSSLLERLHAKFNQNRPWSETIKLVRQVM - UNI5763 - - U

NI14342 - - UNI23316 - EKRVVMSSGGHQHLVSCLETLQKALKV - UNI5583 - VTSLPAMTDRLESIARQNG - UNI23613 - GLGS

HLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPV SCPELVQQLR REKNFEEFSKHLKGLVNLYNLPGDN - UNI7049 - NKLKTKMYL

ALQSLEQDLSKMAIMYW WKATNAAPLDKILHGSVGYLTPRSGG GHLMNMKYYASPSDLLDDKTASPIILHEKNV VPRSLGMNASVTIEGTSAMYKLP

IAPLIMGSHPADNKW WTPSFSAVTSANSVDLPACFFLKFPQPIPVSKAFVQKLQNCTG - UNI9218 - GIPLFETPPTYLPLYELITQFELSKDPD

PLPLNHNMRFYA ALPGQQHCYFLNKDAPLPDGQSLQGTLVSKITFQHPGRVPLILNMIRHQVAYNTLIGSCVKRTILKED DSPGLLQFEVCPLSESRF

SVSFQHPVNDSLVCV VVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQR - UNI19273 - RCMSIPVTMRAIRRKAETIQADTPALSLIAETVE

DMVKKNLPPASSPGYGMTTGNNPMSGTTTPTNTFPGGPITTLFNMSMSIKDRHESVGHGEDFSKVSQNPILTSLLQITGNGGSTIGSSPTPPHHTPPPVS

SMAGNTKNHPMLMNLLKDNPAQDFSTLYGSSPLERQNSSSGSPRMEMCSGSNKAKKKKSSRVPPDKPKHQTEDDFQRELFSMDVDSQNPMFDVSMTADAL

DTPHITPAPSQCSTPPATYPQPVSHPQPSIQRMVRLSSSDSIGPDVTDILSDIAEEASKLPSTSDDCPPIGTPVRDSSSSGHSQSALFDSDVFQTNNNEN

PYTDPADLIADAAGSPNSDSPTNHFFPDGVDFNPDLLNSQSQSGFGEEYFDESSQSGDNDDFKGFASQALNTLGMPMLGGDNGEPKFKGSSQADTVDFSI

ISVAGKALGAADLMEHHSGSQSPLLTTGELGKEKTQKRVKEGNGTGASSGSGPGSDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPFTP

PTSTGGSKSPGSSGRSQTPPGVATPPIPKITIQIPKGTVMVGKPSSHSQYTSSGSVSSSGSKSHHSHSSSSSSLASASTSGKVKSSKSEGSSSSKLSGSM

YASQGSSGSSQSKNSSQTGGKPGSSPITKHGLSSGSSSTKMKPQGKPSSLMNPSISKPNISPSHSRPPGGSDKLASPMKPVPGTPPSSKAKSPISSGSSG

SHVSGTSSSSGMKSSSGSASSGSVSQKTPPASNSCTPSSSSFSSSGSSMSSSQNQHGSSKGKSPSRNKKPSLTAVIDKLKHGVVTSGPGGEDPIDSQMGA

STNSSNHPMSSKHNTSGGEFQSKREKSDKDKSKVSASGGSVDSSKKTSESKNVGSTGVAKIIISKHDGGSPSIKAKVTLQKPGESGGDGLRPQIASSKNY

GSPLISGSTPKHERGSPSHSKSPAYTPQNVDSESESGSSIAERSYQNSPSSEDGIRPLPEYSTEKHKKHKKEKKKVRDKDRDKKKSHSMKPENWSKSPIS

SDPTASVTNNPILSADRPSRLSPDFMIGEEDDDLMDVALIGN
Transcript ENSMUST00000018304
Sequence
TACAGATGCTGGAGCGCCTCCTCCGGGGCGCTGCTCCCCCGTCTCCTCCACTCGTGAAAGGTTTTCTGCGGGACGAGGGACGAGGAAGTTGAGCCTCAGG

 - UNI14342 - - UNI22196 - ACTCAGAGAGGCTGAGTAAGATGAGCTCCCTCCTGGAACGGCTCCATGCAAAATTTAACCAGAACAGACCTTG

GAGTGAAACCATTAAGCTTGTGCGTCAAGTAATG - UNI5763 - - UNI14342 - - UNI23316 - GAGAAGAGGGTCGTAATGAGTTCTGGA

GGGCATCAGCATTTGGTCAGCTGTTTGGAGACATTGCAGAAGGCTCTCAAAG - UNI5583 - TAACATCTTTGCCAGCAATGACTGATCGTTTGGAA

TCTATAGCCAGACAGAATGG - UNI23613 - ACTGGGCTCTCACCTCAGTGCCAGTGGCACTGAGTGTTACATCACGTCAGATATGTTCTATGTGGA

AGTGCAGTTAGATCCTGCAGGACAGCTTTGTGATGTCAAAGTGGCTCACCATGGGGAGAATCCTGTG AGCTGTCCAGAGCTTGTACAGCAGTTAAG GG

AAAAGAATTTTGAGGAATTTTCCAAGCATCTTAAGGGTCTTGTTAATCTGTATAATCTCCCAGGGGACAA - UNI7049 - CAAACTGAAGACTAAAA

TGTATCTGGCTCTCCAATCCTTAGAACAGGACCTTTCTAAAATGGCTATTATGTACTG GAAGGCAACCAACGCCGCTCCCTTGGATAAGATTCTTCATG

GAAGTGTTGGTTATCTCACCCCGCGGAGTGGGG GTCATTTAATGAATATGAAATACTATGCCTCTCCATCTGACCTGCTGGATGATAAGACTGCCTCTC

CTATCATTTTGCATGAAAAGAATG TTCCTCGGTCTTTGGGAATGAATGCCTCAGTGACAATTGAAGGAACCTCTGCTATGTACAAACTCCCAATTGCCC

CATTAATTATGGGGTCACACCCAGCTGACAACAAATG GACCCCTTCTTTCTCCGCAGTCACTAGTGCCAACAGTGTTGATCTTCCTGCGTGTTTCTTCT

TGAAATTTCCCCAGCCAATTCCAGTATCTAAAGCATTTGTTCAGAAACTGCAAAATTGCACAG - UNI9218 - GAATCCCGTTGTTTGAGACTCCGC

CCACTTACCTGCCCCTGTATGAACTCATCACTCAGTTTGAGCTGTCAAAGGATCCTGACCCTTTACCTTTGAATCACAACATGCGATTTTACGCT GCTC

TTCCAGGTCAGCAGCACTGCTATTTTCTCAATAAAGATGCTCCTCTTCCTGATGGTCAGAGCCTGCAGGGAACACTGGTCAGCAAAATCACCTTCCAGCA

CCCTGGCCGAGTTCCTCTTATCTTGAATATGATCAGACACCAAGTGGCCTATAACACTCTAATTGGAAGCTGTGTCAAAAGAACTATTTTAAAAGAAG A

TTCTCCTGGGCTCCTCCAGTTTGAAGTGTGTCCTCTCTCAGAATCTCGCTTCAGTGTATCTTTTCAGCACCCTGTGAATGACTCCCTTGTGTGTG TGGT

GATGGATGTGCAAGACTCAACACATGTGAGCTGTAAACTCTACAAGGGGCTGTCAGATGCACTAATCTGTACAGACGACTTCATTGCCAAAGTTGTTCAA

AG - UNI19273 - ATGTATGTCCATTCCTGTGACGATGAGGGCTATTCGGAGGAAGGCTGAAACCATACAGGCTGACACCCCAGCACTGTCTCTCAT

TGCAGAGACAGTTGAAGACATGGTGAAAAAGAACCTGCCCCCGGCTAGCAGCCCAGGGTATGGCATGACCACAGGCAACAACCCAATGAGTGGTACCACT

ACACCAACCAACACCTTTCCGGGGGGTCCCATTACCACCTTGTTTAATATGAGCATGAGCATCAAAGATCGGCATGAGTCGGTGGGCCATGGGGAGGACT

TCAGCAAGGTGTCTCAGAACCCAATTCTTACCAGTTTGTTGCAAATCACAGGGAACGGGGGGTCTACCATTGGCTCGAGTCCGACCCCTCCTCATCACAC

GCCGCCACCTGTCTCTTCGATGGCCGGCAACACCAAGAACCACCCGATGCTCATGAACCTTCTTAAAGATAACCCTGCCCAGGATTTCTCAACCCTTTAT

GGAAGCAGCCCTTTAGAAAGGCAGAACTCCTCTTCCGGATCACCCCGGATGGAAATGTGCTCGGGGAGCAACAAGGCCAAGAAGAAGAAGTCGTCAAGAG

TCCCACCTGACAAACCCAAGCACCAGACTGAAGACGATTTCCAGAGGGAGCTCTTTTCCATGGATGTCGACTCACAGAACCCTATGTTTGACGTCAGCAT

GACCGCTGACGCGCTGGATACACCTCATATCACCCCAGCTCCAAGCCAGTGTAGCACTCCCCCAGCAACGTACCCACAGCCAGTGTCTCACCCCCAGCCC

AGTATTCAGAGGATGGTCCGACTGTCCAGTTCAGACAGCATTGGCCCAGATGTAACTGATATTCTTTCAGATATTGCCGAAGAAGCTTCAAAGCTTCCCA

GCACGAGTGATGACTGCCCACCAATTGGCACCCCTGTTCGAGATTCCTCAAGTTCTGGGCATTCTCAGAGTGCCCTCTTTGATTCTGATGTCTTTCAAAC

TAATAATAATGAAAATCCATACACTGATCCAGCTGACCTTATTGCAGATGCTGCTGGAAGCCCCAATAGTGATTCTCCTACCAATCATTTTTTCCCTGAT

GGAGTAGATTTCAATCCTGATTTGTTGAACAGCCAAAGCCAAAGTGGTTTTGGAGAGGAGTATTTTGATGAAAGTAGTCAGAGTGGGGATAATGATGATT

TCAAAGGATTTGCATCTCAGGCATTAAATACATTGGGGATGCCAATGCTTGGAGGTGACAATGGGGAGCCAAAATTTAAGGGCAGCAGCCAGGCTGACAC

GGTGGACTTCAGTATTATATCAGTAGCCGGTAAGGCTTTGGGTGCTGCAGATCTGATGGAGCACCACAGTGGGAGTCAGAGTCCTTTACTGACCACTGGA

GAATTAGGGAAAGAAAAAACTCAAAAGAGGGTGAAGGAAGGCAACGGCACAGGTGCTAGCAGTGGATCAGGTCCAGGGTCAGACAGCAAGCCAGGCAAGC

GCAGCCGCACTCCCTCCAATGATGGGAAGAGCAAGGATAAGCCTCCAAAGCGGAAGAAGGCAGACACTGAGGGGAAGTCCCCATCTCACAGTTCTTCTAA

TAGACCTTTCACCCCACCTACCAGCACGGGTGGGTCCAAATCCCCAGGCAGTTCAGGACGATCTCAGACGCCCCCAGGTGTTGCCACCCCGCCCATTCCC

AAGATTACCATTCAGATTCCTAAAGGGACAGTGATGGTGGGCAAGCCCTCCTCTCACAGTCAGTACACTAGCAGTGGTTCTGTGTCTTCCTCTGGCAGCA

AAAGCCACCATAGTCATTCTTCCTCCTCCTCTTCCTTAGCTTCTGCTTCCACCTCAGGCAAGGTGAAAAGCAGTAAATCTGAAGGCTCATCAAGTTCCAA

GCTCAGTGGCAGTATGTATGCTAGCCAAGGGTCTTCTGGATCCAGCCAGTCCAAAAATTCATCTCAGACTGGGGGGAAGCCAGGCTCCTCTCCCATTACC

AAACATGGACTGAGCAGTGGGTCCAGCAGTACCAAGATGAAACCTCAAGGCAAGCCATCCTCCCTTATGAACCCTTCTATAAGTAAGCCAAACATATCCC

CTTCCCATTCAAGGCCTCCCGGAGGCTCAGATAAGCTTGCCTCTCCAATGAAGCCTGTTCCTGGAACCCCCCCATCCTCTAAAGCCAAGTCCCCTATCAG

TTCAGGTTCCAGTGGTTCTCATGTGTCAGGAACTAGTTCAAGCTCTGGTATGAAGTCATCTTCAGGGTCAGCATCCTCAGGCTCAGTGTCTCAAAAAACC

CCTCCAGCATCTAATTCTTGTACACCATCTTCCTCTTCGTTTTCCTCAAGTGGTTCTTCCATGTCATCCTCTCAGAATCAACATGGCAGTTCCAAAGGGA

AATCTCCCAGTAGGAATAAGAAGCCTTCCTTGACAGCTGTCATAGATAAATTGAAGCATGGGGTGGTTACCAGTGGGCCTGGGGGTGAGGATCCAATAGA

CAGTCAGATGGGCGCAAGCACAAATTCTTCTAACCATCCCATGTCCTCCAAACATAACACGTCAGGAGGGGAGTTCCAGAGCAAACGTGAGAAAAGTGAT

AAAGACAAATCCAAGGTCTCTGCTTCTGGGGGGTCAGTGGATTCCTCTAAGAAGACTTCAGAGTCAAAAAATGTGGGGAGCACGGGGGTGGCAAAAATCA

TTATCAGCAAGCACGACGGAGGCTCCCCGAGCATCAAAGCCAAAGTGACGCTACAGAAACCTGGAGAAAGTGGTGGAGATGGGCTCAGGCCACAGATAGC

CTCATCAAAGAACTATGGCTCTCCACTTATCAGTGGTTCCACTCCAAAGCACGAACGGGGTTCTCCCAGCCACAGTAAGTCGCCAGCATATACACCACAG

AATGTGGACAGTGAAAGTGAGTCAGGCTCCTCCATAGCAGAGAGATCCTACCAGAACAGTCCCAGCTCAGAGGATGGTATCCGACCACTTCCAGAGTACA

GCACTGAGAAGCATAAGAAGCACAAAAAGGAAAAGAAGAAAGTCAGAGACAAAGACAGAGACAAGAAGAAGTCTCACAGCATGAAGCCAGAGAACTGGTC

GAAATCCCCCATTTCTTCAGATCCGACGGCGTCTGTGACAAATAACCCTATCTTATCTGCAGACAGGCCTTCTAGGCTCAGCCCTGACTTCATGATTGGG

GAGGAAGATGATGATCTCATGGATGTGGCCCTGATTGGCAATTAGCCTAACTTTCTAAACAGACACGTCCAGAGGAGAAACTAATGATATATGTAAACCA

ACCCGAGGGGTGAGTCAGACAGGCCCTGTCAGTGCTTAAGAGCCCTAAAGGGCATGGCCTCTACACCAAGCTGGGTACATTTATAAACATACATCTAGAC

CCTGCTGCCGAAACCATGTGGTTGGTTGTTCAGAAACAAGTCATATTTCTTTGCCAGAAAGCAATGAATAAATTACTTGCTTAAGGGGAGAGGGGTGGTG

GGAGAGGGTGTAGAGAGGGAGGGGTGGGAAATTGTTGTGGGAAATATTCATATATTTTTCTCCCTTTTTCCATTTTCAGGACATGCTTTAAACTCATTTT

AGTGCATGTATTTGAAGGGCTGGGCAGAAAATGAAAAAGCAATACATTCCTTGATGCATTCGCATGAAGGTTGCTCACCTGTGGGAGATGCCCATTGGAA

GCATGGGCACGGGAAGGACTTTGACAGTTCTGGACACTGAAAGCAATGTTTGGTGTCTGTTTCTTAGGAGTGATGGGGGAGGGAAAATTATTTTAGTTAT

TTATTTGTAATATTTTAATCCTTGATGTTTGTTTTTATGCAATGTTTGTTCCTAAATCTATGAAGGTTATGGTTCAGAACAGTAGGAGGCAGGTAGCAAG

GCTCGCCTGGTGGGGAGCTCGCAGCCTGTGCTGACGCTGCAGCACCAGTCCCACAGAGCTAATCACAGCCTGTCTTTGGAGTTGAATAGAAAAACCAAAA

CTATTATCTTTGGAGGTTTTTCACAGGGTTCAGACACCATAGGAATATTAGGAGTGAGTTACCTCCCTATGCAGATAAAAGATTTATCTTCTTTCATTAA

AAAGGAAGGGTGGCTTTGGGGGGTATACATTTGTTTTCAGAGTCTATACCCTATCGTATAAAAATCAGTATAGAATTAATAGTTCTCCTACTTCCACAAT

GTGCCAAAAGTCTACATCCCAGCATTTTGTTTGCAGGAGAGCTGATGCCATTCCTAAGAGCTGGACTCTTTGTTTCTCTTCATCACAAGAAGAAGGAGTT

CAGACTTAAATCACTCCACTGTATGCTCCCCGAGATAAACAGTTAAAAAAAAAAAAAGCAGCCATAGTTCACTTAAAACAATTTCAAGCTCACTTGAAGT

GATTAGGGCCTGGAATGCTAAGTGAGCATGAAGATAACCCTTGCTACCGTGTAGCACACAGTCGGACCTTTTTGGAGAAACAGGTCTGAGTCTGGATTCT

GAGGGACATCAAAGGAAGACCTCATAAATAGAGAAATGCAGGAGACCGTTTTGAGTGCAACAGAAGTTCTCAGTATTTGGAGGGTCCTCTCAAAAGTCCG

CGGCCTTACTTTGATTTCACCACCTGCACTGTGCCATTCCTGATGATTCCGTTTGGGATCTGTATCAGCGGGGTGGGGGTGGGGCGTGATCCCCAGCACA

ACTCTTCTGGATTACAAAACAAGCAAAAGCCAGGTGATTCATGTTTGTGTGTGTTATAAGTGGAGTGACTTCATCAGATACGGACGATTTCTACATCCAA

CACTGCAGGTTGTTGGAGTTAGCAT
Translation
 - UNI14342 - - UNI22196 - MSSLLERLHAKFNQNRPWSETIKLVRQVM - UNI5763 - - UNI14342 - - UNI23316 - EKRVV

MSSGGHQHLVSCLETLQKALKV - UNI5583 - VTSLPAMTDRLESIARQNG - UNI23613 - GLGSHLSASGTECYITSDMFYVEVQLDPAGQL

CDVKVAHHGENPV SCPELVQQLR REKNFEEFSKHLKGLVNLYNLPGDN - UNI7049 - NKLKTKMYLALQSLEQDLSKMAIMYW WKATNAAPLD

KILHGSVGYLTPRSGG GHLMNMKYYASPSDLLDDKTASPIILHEKNV VPRSLGMNASVTIEGTSAMYKLPIAPLIMGSHPADNKW WTPSFSAVTSAN

SVDLPACFFLKFPQPIPVSKAFVQKLQNCTG - UNI9218 - GIPLFETPPTYLPLYELITQFELSKDPDPLPLNHNMRFYA ALPGQQHCYFLNKDA

PLPDGQSLQGTLVSKITFQHPGRVPLILNMIRHQVAYNTLIGSCVKRTILKED DSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCV VVMDVQDSTHVS

CKLYKGLSDALICTDDFIAKVVQR - UNI19273 - RCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGYGMTTGNNPMSGTT

TPTNTFPGGPITTLFNMSMSIKDRHESVGHGEDFSKVSQNPILTSLLQITGNGGSTIGSSPTPPHHTPPPVSSMAGNTKNHPMLMNLLKDNPAQDFSTLY

GSSPLERQNSSSGSPRMEMCSGSNKAKKKKSSRVPPDKPKHQTEDDFQRELFSMDVDSQNPMFDVSMTADALDTPHITPAPSQCSTPPATYPQPVSHPQP

SIQRMVRLSSSDSIGPDVTDILSDIAEEASKLPSTSDDCPPIGTPVRDSSSSGHSQSALFDSDVFQTNNNENPYTDPADLIADAAGSPNSDSPTNHFFPD

GVDFNPDLLNSQSQSGFGEEYFDESSQSGDNDDFKGFASQALNTLGMPMLGGDNGEPKFKGSSQADTVDFSIISVAGKALGAADLMEHHSGSQSPLLTTG

ELGKEKTQKRVKEGNGTGASSGSGPGSDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPFTPPTSTGGSKSPGSSGRSQTPPGVATPPIP

KITIQIPKGTVMVGKPSSHSQYTSSGSVSSSGSKSHHSHSSSSSSLASASTSGKVKSSKSEGSSSSKLSGSMYASQGSSGSSQSKNSSQTGGKPGSSPIT

KHGLSSGSSSTKMKPQGKPSSLMNPSISKPNISPSHSRPPGGSDKLASPMKPVPGTPPSSKAKSPISSGSSGSHVSGTSSSSGMKSSSGSASSGSVSQKT

PPASNSCTPSSSSFSSSGSSMSSSQNQHGSSKGKSPSRNKKPSLTAVIDKLKHGVVTSGPGGEDPIDSQMGASTNSSNHPMSSKHNTSGGEFQSKREKSD

KDKSKVSASGGSVDSSKKTSESKNVGSTGVAKIIISKHDGGSPSIKAKVTLQKPGESGGDGLRPQIASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQ

NVDSESESGSSIAERSYQNSPSSEDGIRPLPEYSTEKHKKHKKEKKKVRDKDRDKKKSHSMKPENWSKSPISSDPTASVTNNPILSADRPSRLSPDFMIG

EEDDDLMDVALIGN
Transcript ENSMUST00000107541
Sequence
GATCTTTGGGAAGTTCCGTTGGGGAAGATGGCGGCGGCCGCGAGCACCCTTCTCTTCTTGCCGCCGGGGACTTCAGACTGAGCCTTCCCCGGAAGAGTCG

GGGCCGCTGGTGCGCCGCTTCCCCGGAGCCCAGGCTAACTTGGTTCCCCTCTGAGTGGCGGGGAAAGGCTCCCCGGCTCGTGGCGGACCCAAGACCTCCC

CGCTGTCAGGATGAAGGCTCAGGGGGAAACCGAGG - UNI5529 - - UNI14342 - - UNI22196 - ACTCAGAGAGGCTGAGTAAGATGAGC

TCCCTCCTGGAACGGCTCCATGCAAAATTTAACCAGAACAGACCTTGGAGTGAAACCATTAAGCTTGTGCGTCAAGTAATG - UNI5763 - - UNI1

4342 - - UNI23316 - GAGAAGAGGGTCGTAATGAGTTCTGGAGGGCATCAGCATTTGGTCAGCTGTTTGGAGACATTGCAGAAGGCTCTCAAAG 

- UNI5583 - TAACATCTTTGCCAGCAATGACTGATCGTTTGGAATCTATAGCCAGACAGAATGG - UNI23613 - ACTGGGCTCTCACCTCAGT

GCCAGTGGCACTGAGTGTTACATCACGTCAGATATGTTCTATGTGGAAGTGCAGTTAGATCCTGCAGGACAGCTTTGTGATGTCAAAGTGGCTCACCATG

GGGAGAATCCTGTG AGCTGTCCAGAGCTTGTACAGCAGTTAAG GGAAAAGAATTTTGAGGAATTTTCCAAGCATCTTAAGGGTCTTGTTAATCTGTAT

AATCTCCCAGGGGACAA - UNI7049 - CAAACTGAAGACTAAAATGTATCTGGCTCTCCAATCCTTAGAACAGGACCTTTCTAAAATGGCTATTATG

TACTG GAAGGCAACCAACGCCGCTCCCTTGGATAAGATTCTTCATGGAAGTGTTGGTTATCTCACCCCGCGGAGTGGGG GTCATTTAATGAATATGAA

ATACTATGCCTCTCCATCTGACCTGCTGGATGATAAGACTGCCTCTCCTATCATTTTGCATGAAAAGAATG TTCCTCGGTCTTTGGGAATGAATGCCTC

AGTGACAATTGAAGGAACCTCTGCTATGTACAAACTCCCAATTGCCCCATTAATTATGGGGTCACACCCAGCTGACAACAAATG GACCCCTTCTTTCTC

CGCAGTCACTAGTGCCAACAGTGTTGATCTTCCTGCGTGTTTCTTCTTGAAATTTCCCCAGCCAATTCCAGTATCTAAAGCATTTGTTCAGAAACTGCAA

AATTGCACAG - UNI9218 - GAATCCCGTTGTTTGAGACTCCGCCCACTTACCTGCCCCTGTATGAACTCATCACTCAGTTTGAGCTGTCAAAGGAT

CCTGACCCTTTACCTTTGAATCACAACATGCGATTTTACGCT GCTCTTCCAGGTCAGCAGCACTGCTATTTTCTCAATAAAGATGCTCCTCTTCCTGAT

GGTCAGAGCCTGCAGGGAACACTGGTCAGCAAAATCACCTTCCAGCACCCTGGCCGAGTTCCTCTTATCTTGAATATGATCAGACACCAAGTGGCCTATA

ACACTCTAATTGGAAGCTGTGTCAAAAGAACTATTTTAAAAGAAG ATTCTCCTGGGCTCCTCCAGTTTGAAGTGTGTCCTCTCTCAGAATCTCGCTTCA

GTGTATCTTTTCAGCACCCTGTGAATGACTCCCTTGTGTGTG TGGTGATGGATGTGCAAGACTCAACACATGTGAGCTGTAAACTCTACAAGGGGCTGT

CAGATGCACTAATCTGTACAGACGACTTCATTGCCAAAGTTGTTCAAAG - UNI19273 - ATGTATGTCCATTCCTGTGACGATGAGGGCTATTCGG

AGGAAGGCTGAAACCATACAGGCTGACACCCCAGCACTGTCTCTCATTGCAGAGACAGTTGAAGACATGGTGAAAAAGAACCTGCCCCCGGCTAGCAGCC

CAGGGTATGGCATGACCACAGGCAACAACCCAATGAGTGGTACCACTACACCAACCAACACCTTTCCGGGGGGTCCCATTACCACCTTGTTTAATATGAG

CATGAGCATCAAAGATCGGCATGAGTCGGTGGGCCATGGGGAGGACTTCAGCAAGGTGTCTCAGAACCCAATTCTTACCAGTTTGTTGCAAATCACAGGG

AACGGGGGGTCTACCATTGGCTCGAGTCCGACCCCTCCTCATCACACGCCGCCACCTGTCTCTTCGATGGCCGGCAACACCAAGAACCACCCGATGCTCA

TGAACCTTCTTAAAGATAACCCTGCCCAGGATTTCTCAACCCTTTATGGAAGCAGCCCTTTAGAAAGGCAGAACTCCTCTTCCGGATCACCCCGGATGGA

AATGTGCTCGGGGAGCAACAAGGCCAAGAAGAAGAAGTCGTCAAGAGTCCCACCTGACAAACCCAAGCACCAGACTGAAGACGATTTCCAGAGGGAGCTC

TTTTCCATGGATGTCGACTCACAGAACCCTATGTTTGACGTCAGCATGACCGCTGACGCGCTGGATACACCTCATATCACCCCAGCTCCAAGCCAGTGTA

GCACTCCCCCAGCAACGTACCCACAGCCAGTGTCTCACCCCCAGCCCAGTATTCAGAGGATGGTCCGACTGTCCAGTTCAGACAGCATTGGCCCAGATGT

AACTGATATTCTTTCAGATATTGCCGAAGAAGCTTCAAAGCTTCCCAGCACGAGTGATGACTGCCCACCAATTGGCACCCCTGTTCGAGATTCCTCAAGT

TCTGGGCATTCTCAGAGTGCCCTCTTTGATTCTGATGTCTTTCAAACTAATAATAATGAAAATCCATACACTGATCCAGCTGACCTTATTGCAGATGCTG

CTGGAAGCCCCAATAGTGATTCTCCTACCAATCATTTTTTCCCTGATGGAGTAGATTTCAATCCTGATTTGTTGAACAGCCAAAGCCAAAGTGGTTTTGG

AGAGGAGTATTTTGATGAAAGTAGTCAGAGTGGGGATAATGATGATTTCAAAGGATTTGCATCTCAGGCATTAAATACATTGGGGATGCCAATGCTTGGA

GGTGACAATGGGGAGCCAAAATTTAAGGGCAGCAGCCAGGCTGACACGGTGGACTTCAGTATTATATCAGTAGCCGGTAAGGCTTTGGGTGCTGCAGATC

TGATGGAGCACCACAGTGGGAGTCAGAGTCCTTTACTGACCACTGGAGAATTAGGGAAAGAAAAAACTCAAAAGAGGGTGAAGGAAGGCAACGGCACAGG

TGCTAGCAGTGGATCAGGTCCAGGGTCAGACAGCAAGCCAGGCAAGCGCAGCCGCACTCCCTCCAATGATGGGAAGAGCAAGGATAAGCCTCCAAAGCGG

AAGAAGGCAGACACTGAGGGGAAGTCCCCATCTCACAGTTCTTCTAATAGACCTTTCACCCCACCTACCAGCACGGGTGGGTCCAAATCCCCAGGCAGTT

CAGGACGATCTCAGACGCCCCCAGGTGTTGCCACCCCGCCCATTCCCAAGATTACCATTCAGATTCCTAAAGGGACAGTGATGGTGGGCAAGCCCTCCTC

TCACAGTCAGTACACTAGCAGTGGTTCTGTGTCTTCCTCTGGCAGCAAAAGCCACCATAGTCATTCTTCCTCCTCCTCTTCCTTAGCTTCTGCTTCCACC

TCAGGCAAGGTGAAAAGCAGTAAATCTGAAGGCTCATCAAGTTCCAAGCTCAGTGGCAGTATGTATGCTAGCCAAGGGTCTTCTGGATCCAGCCAGTCCA

AAAATTCATCTCAGACTGGGGGGAAGCCAGGCTCCTCTCCCATTACCAAACATGGACTGAGCAGTGGGTCCAGCAGTACCAAGATGAAACCTCAAGGCAA

GCCATCCTCCCTTATGAACCCTTCTATAAGTAAGCCAAACATATCCCCTTCCCATTCAAGGCCTCCCGGAGGCTCAGATAAGCTTGCCTCTCCAATGAAG

CCTGTTCCTGGAACCCCCCCATCCTCTAAAGCCAAGTCCCCTATCAGTTCAGGTTCCAGTGGTTCTCATGTGTCAGGAACTAGTTCAAGCTCTGGTATGA

AGTCATCTTCAGGGTCAGCATCCTCAGGCTCAGTGTCTCAAAAAACCCCTCCAGCATCTAATTCTTGTACACCATCTTCCTCTTCGTTTTCCTCAAGTGG

TTCTTCCATGTCATCCTCTCAGAATCAACATGGCAGTTCCAAAGGGAAATCTCCCAGTAGGAATAAGAAGCCTTCCTTGACAGCTGTCATAGATAAATTG

AAGCATGGGGTGGTTACCAGTGGGCCTGGGGGTGAGGATCCAATAGACAGTCAGATGGGCGCAAGCACAAATTCTTCTAACCATCCCATGTCCTCCAAAC

ATAACACGTCAGGAGGGGAGTTCCAGAGCAAACGTGAGAAAAGTGATAAAGACAAATCCAAGGTCTCTGCTTCTGGGGGGTCAGTGGATTCCTCTAAGAA

GACTTCAGAGTCAAAAAATGTGGGGAGCACGGGGGTGGCAAAAATCATTATCAGCAAGCACGACGGAGGCTCCCCGAGCATCAAAGCCAAAGTGACGCTA

CAGAAACCTGGAGAAAGTGGTGGAGATGGGCTCAGGCCACAGATAGCCTCATCAAAGAACTATGGCTCTCCACTTATCAGTGGTTCCACTCCAAAGCACG

AACGGGGTTCTCCCAGCCACAGTAAGTCGCCAGCATATACACCACAGAATGTGGACAGTGAAAGTGAGTCAGGCTCCTCCATAGCAGAGAGATCCTACCA

GAACAGTCCCAGCTCAGAGGATGGTATCCGACCACTTCCAGAGTACAGCACTGAGAAGCATAAGAAGCACAAAAAGGAAAAGAAGAAAGTCAGAGACAAA

GACAGAGACAAGAAGAAGTCTCACAGCATGAAGCCAGAGAACTGGTCGAAATCCCCCATTTCTTCAGATCCGACGGCGTCTGTGACAAATAACCCTATCT

TATCTGCAGACAGGCCTTCTAGGCTCAGCCCTGACTTCATGATTGGGGAGGAAGATGATGATCTCATGGATGTGGCCCTGATTGGCAATTAG
Translation
 - UNI5529 - - UNI14342 - - UNI22196 - MSSLLERLHAKFNQNRPWSETIKLVRQVM - UNI5763 - - UNI14342 - - UNI2

3316 - EKRVVMSSGGHQHLVSCLETLQKALKV - UNI5583 - VTSLPAMTDRLESIARQNG - UNI23613 - GLGSHLSASGTECYITSDMF

YVEVQLDPAGQLCDVKVAHHGENPV SCPELVQQLR REKNFEEFSKHLKGLVNLYNLPGDN - UNI7049 - NKLKTKMYLALQSLEQDLSKMAIMY

W WKATNAAPLDKILHGSVGYLTPRSGG GHLMNMKYYASPSDLLDDKTASPIILHEKNV VPRSLGMNASVTIEGTSAMYKLPIAPLIMGSHPADNKW 

WTPSFSAVTSANSVDLPACFFLKFPQPIPVSKAFVQKLQNCTG - UNI9218 - GIPLFETPPTYLPLYELITQFELSKDPDPLPLNHNMRFYA ALP

GQQHCYFLNKDAPLPDGQSLQGTLVSKITFQHPGRVPLILNMIRHQVAYNTLIGSCVKRTILKED DSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCV 

VVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQR - UNI19273 - RCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGYG

MTTGNNPMSGTTTPTNTFPGGPITTLFNMSMSIKDRHESVGHGEDFSKVSQNPILTSLLQITGNGGSTIGSSPTPPHHTPPPVSSMAGNTKNHPMLMNLL

KDNPAQDFSTLYGSSPLERQNSSSGSPRMEMCSGSNKAKKKKSSRVPPDKPKHQTEDDFQRELFSMDVDSQNPMFDVSMTADALDTPHITPAPSQCSTPP

ATYPQPVSHPQPSIQRMVRLSSSDSIGPDVTDILSDIAEEASKLPSTSDDCPPIGTPVRDSSSSGHSQSALFDSDVFQTNNNENPYTDPADLIADAAGSP

NSDSPTNHFFPDGVDFNPDLLNSQSQSGFGEEYFDESSQSGDNDDFKGFASQALNTLGMPMLGGDNGEPKFKGSSQADTVDFSIISVAGKALGAADLMEH

HSGSQSPLLTTGELGKEKTQKRVKEGNGTGASSGSGPGSDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPFTPPTSTGGSKSPGSSGRS

QTPPGVATPPIPKITIQIPKGTVMVGKPSSHSQYTSSGSVSSSGSKSHHSHSSSSSSLASASTSGKVKSSKSEGSSSSKLSGSMYASQGSSGSSQSKNSS

QTGGKPGSSPITKHGLSSGSSSTKMKPQGKPSSLMNPSISKPNISPSHSRPPGGSDKLASPMKPVPGTPPSSKAKSPISSGSSGSHVSGTSSSSGMKSSS

GSASSGSVSQKTPPASNSCTPSSSSFSSSGSSMSSSQNQHGSSKGKSPSRNKKPSLTAVIDKLKHGVVTSGPGGEDPIDSQMGASTNSSNHPMSSKHNTS

GGEFQSKREKSDKDKSKVSASGGSVDSSKKTSESKNVGSTGVAKIIISKHDGGSPSIKAKVTLQKPGESGGDGLRPQIASSKNYGSPLISGSTPKHERGS

PSHSKSPAYTPQNVDSESESGSSIAERSYQNSPSSEDGIRPLPEYSTEKHKKHKKEKKKVRDKDRDKKKSHSMKPENWSKSPISSDPTASVTNNPILSAD

RPSRLSPDFMIGEEDDDLMDVALIGN

For any suggestions or comments, please send an email to unitrap@crg.es