Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000018411 (Mapt)
Chromosomal location
Chr 11: 104092812 - 104190492 (+)
Description
microtubule-associated protein tau Gene [Source:MGI (curated);Acc:Mapt-003]
RefSeq_dna
NM_001038609 NM_010838 
RefSeq_peptide
NP_001033698.1 NP_034968.3 
UniGene
Mm.1287 
MGI
MGI:97180 
Uniprot/SWISSPROT
P10637 
Uniprot/SPTREMBL
A2A5Y6 Q76M61 Q8C5K4 B1AQW3 Q3UH19 B1AQW2 Q547J4 B1AQW5 B1AQW6 
Human Ortholog
ENSG00000186868 (MAPT)
Omim 157140 - MICROTUBULE-ASSOCIATED PROTEIN TAU  172700 - PICK DISEASE OF BRAIN  260540 - PARKINSON-DEMENTIA SYNDROME  600274 - FRONTOTEMPORAL DEMENTIA  601104 - SUPRANUCLEAR PALSY, PROGRESSIVE, 1  607485 - FRONTOTEMPORAL LOBAR DEGENERATION WITH UBIQUITIN-POSITIVE INCLUSIONS;  
UniTrap UNI30181
Vector Insertion
Chr 11: 104092922 - 104143694
Public Clones D088C04 (ggtc) PST18091-NL (escells) IST10548H10 (tigm) IST14541H10 (tigm)
IST12453F7 (tigm) IST12430H2 (tigm) IST15076F8 (tigm) IST15108H9 (tigm)
IST14934F7 (tigm) IST14850G2 (tigm) IST12507G7 (tigm) IST13122B7 (tigm)
IST10855F7 (tigm) IST12395E2 (tigm) IST13631E8 (tigm) IST10570A7 (tigm)
IST14792H11 (tigm) IST10994B8 (tigm) IST14279F4 (tigm) IST12302H2 (tigm)
IST14279E4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18971
Vector Insertion
Chr 11: 104143681 - 104143795
Public Clones not available
Private Clones OST408502 (lexicon) OST280711 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32535
Vector Insertion
Chr 11: 104143795 - 104148436
Public Clones IST10278A1 (tigm) IST10145A3 (tigm) IST14234F2 (tigm) IST14817D7 (tigm)
IST11610D10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30826
Vector Insertion
Chr 11: 104148524 - 104151221
Public Clones (ggtc) IST13644G12 (tigm) IST13528F11 (tigm) IST13751H10 (tigm) IST14136B10 (tigm)
IST13174F1 (tigm) IST11995F7 (tigm) IST14388F6 (tigm) IST11435A3 (tigm)
IST10021A8 (tigm) IST14249G3 (tigm) IST10019C3 (tigm) IST12037H10 (tigm)
IST12649D12 (tigm) IST14533D12 (tigm) IST10202F8 (tigm) IST10436C6 (tigm)
IST10806G8 (tigm) IST10131E7 (tigm) IST10054G10 (tigm) IST12376D12 (tigm)
IST12337E10 (tigm) IST10785E6 (tigm) IST12465G2 (tigm) IST11609A12 (tigm)
IST15074B6 (tigm) IST11746H3 (tigm) IST10591E5 (tigm) IST10512E6 (tigm)
IST11887E9 (tigm) IST13043H7 (tigm) IST10652E4 (tigm) IST12227C1 (tigm)
IST11684G12 (tigm) IST12241F10 (tigm) IST12783G11 (tigm) IST10031E4 (tigm)
IST12444D4 (tigm) IST11131D9 (tigm) IST11348B3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27131
Vector Insertion
Chr 11: 104151309 - 104156172
Public Clones D103F07 (ggtc) IST10105F3 (tigm) IST12039A9 (tigm) IST14711D2 (tigm)
IST14418C10 (tigm) IST10952F4 (tigm) IST14797A6 (tigm) IST12314A10 (tigm)
IST12246G6 (tigm) IST10969D5 (tigm) IST11930B3 (tigm) IST10042A4 (tigm)
IST10170B1 (tigm) IST12009C3 (tigm) IST13117F8 (tigm) IST10162A11 (tigm)
IST10641H3 (tigm) IST14674G10 (tigm) IST12446C4 (tigm) IST12140D9 (tigm)
IST10816A3 (tigm) IST12795D11 (tigm) IST11443D7 (tigm) IST11707G2 (tigm)
IST10741D11 (tigm) IST13091F11BBF1 (tigm) IST11443E4 (tigm) IST12147H5 (tigm)
IST12446G11 (tigm) IST14418H4 (tigm) IST12087F6 (tigm) IST14921C6 (tigm)
IST13126B10 (tigm) IST12156A7 (tigm) IST12069G10 (tigm) IST13111F6 (tigm)
IST13120F10 (tigm) IST15002D12 (tigm) IST11561B6 (tigm) IST15002C12 (tigm)
IST11089F2 (tigm) IST10194B6 (tigm) IST10073H4 (tigm) IST14617G5 (tigm)
IST13074D12 (tigm) IST13474C10 (tigm) IST11392D11 (tigm) IST10205C1 (tigm)
IST11924D5HMF1 (tigm) IST12041B3 (tigm) IST13091D4 (tigm) IST12437E11 (tigm)
IST12054A3 (tigm) IST12060C2 (tigm) IST12645F5 (tigm) IST13109A11 (tigm)
IST14139E6 (tigm) IST11601E9 (tigm) IST12975A12 (tigm) IST15002B12 (tigm)
IST10758D6 (tigm) IST14742E10 (tigm)
Private Clones OST68940 (lexicon) OST68924 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11577
Vector Insertion
Chr 11: 104156172 - 104156239
Public Clones P065H01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30785
Vector Insertion
Chr 11: 104156239 - 104159811
Public Clones IST14620B8 (tigm) IST12913F12 (tigm) IST15059E3 (tigm) IST12912H12 (tigm)
IST10741G7 (tigm) IST12032E5 (tigm) IST12534C8 (tigm) IST14448E2 (tigm)
IST10408G10 (tigm) IST14952G11 (tigm) IST11109G4 (tigm) IST11908E12 (tigm)
IST11063C9 (tigm) IST11908F12 (tigm) IST11908G12 (tigm) IST10393H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14237
Vector Insertion
Chr 11: 104160571 - 104163674
Public Clones FHCRC-GT-S23-5D1 (fhcrc) IST14540C9 (tigm) IST13057D5 (tigm) IST14178B12 (tigm)
IST13053F1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20720
Vector Insertion
Chr 11: 104163674 - 104163725
Public Clones not available
Private Clones OST353797 (lexicon) OST346887 (lexicon) OST341011 (lexicon) OST334787 (lexicon)
OST238946 (lexicon) OST38078 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32177
Vector Insertion
Chr 11: 104163725 - 104166525
Public Clones PST18265-NL (escells) IST12513B1 (tigm) IST12667A8 (tigm) IST10537F6 (tigm)
IST11169A8 (tigm) IST14722A3 (tigm) IST11356A2 (tigm) IST11930F10 (tigm)
IST10690F6 (tigm) IST10181H10 (tigm) IST12415C9 (tigm) IST12010G2 (tigm)
IST14838D1 (tigm) IST14868A4 (tigm) IST10982C1 (tigm) IST10765B11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14800
Vector Insertion
Chr 11: 104166724 - 104167939
Public Clones PST14692-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31333
Vector Insertion
Chr 11: 104166724 - 104167939
Public Clones IST14339F10 (tigm) IST14932C2 (tigm) IST13360D4 (tigm) IST10930H5 (tigm)
IST13786F4 (tigm) IST11670C12 (tigm) IST10389B2 (tigm) IST10026A3 (tigm)
IST11462C10 (tigm) IST10005D2 (tigm) IST14961F4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16863
Vector Insertion
Chr 11: 104167939 - 104168073
Public Clones not available
Private Clones OST453108 (lexicon) OST388447 (lexicon) OST356712 (lexicon) OST355597 (lexicon)
OST271272 (lexicon) OST127103 (lexicon)
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31128
Vector Insertion
Chr 11: 104168073 - 104169194
Public Clones (ggtc) IST11686F8 (tigm) IST10389B2 (tigm) IST12804B4 (tigm) IST12804B2 (tigm)
IST10774C6 (tigm) IST10115F5 (tigm) IST10948D8 (tigm) IST11217A7 (tigm)
IST12846A1 (tigm) IST10115E5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30541
Vector Insertion
Chr 11: 104169249 - 104171582
Public Clones IST10372D11BBF1 (tigm) IST14276H5 (tigm) IST11499H12 (tigm) IST12241E12 (tigm)
IST10283F9 (tigm) IST14865A2 (tigm) IST11262D2 (tigm) IST14840G8 (tigm)
IST10630D5 (tigm) IST10654C9 (tigm) IST10249A2 (tigm) IST11531D8 (tigm)
IST10239F12 (tigm) IST14970G11 (tigm) IST10623H11 (tigm) IST11849H6 (tigm)
IST14728C1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13141
Vector Insertion
Chr 11: 104171582 - 104171849
Public Clones CMHD-GT_323A4-3 (cmhd)
Private Clones OST459608 (lexicon) OST439768 (lexicon) OST425775 (lexicon) OST404466 (lexicon)
OST388729 (lexicon) OST283066 (lexicon) OST251264 (lexicon) OST202241 (lexicon)
OST193675 (lexicon) OST153359 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30920
Vector Insertion
Chr 11: 104171849 - 104179470
Public Clones CMHD-GT_539C4-5S (cmhd) IST10565E12 (tigm) IST11204E12 (tigm) IST11293D2 (tigm)
IST11812E6 (tigm) IST10408G12 (tigm) IST14934C4 (tigm) IST10083G2 (tigm)
IST10121G10 (tigm) IST14445B10 (tigm) IST10737F3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20978
Vector Insertion
Chr 11: 104179564 - 104182664
Public Clones CMHD-GT_539C4-3 (cmhd) CMHD-GT_466E5-3 (cmhd) IST14551H7 (tigm) IST12821H12 (tigm)
IST11026E8 (tigm)
Private Clones OST346870 (lexicon) OST261212 (lexicon) OST250000 (lexicon) OST246173 (lexicon)
OST151565 (lexicon) OST112192 (lexicon) OST103001 (lexicon) OST65769 (lexicon)
OST31377 (lexicon) OST30969 (lexicon) OST19063 (lexicon) OST18512 (lexicon)
OST17722 (lexicon) OST15575 (lexicon)
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13054
Vector Insertion
Chr 11: 104182664 - 104182747
Public Clones CMHD-GT_342G5-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24298
Vector Insertion
Chr 11: 104182747 - 104183741
Public Clones IST12078A7 (tigm)
Private Clones OST225320 (lexicon)
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4947
Vector Insertion
Chr 11: 104183741 - 104183855
Public Clones AN0930 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25423
Vector Insertion
Chr 11: 104183855 - 104189285
Public Clones not available
Private Clones OST184482 (lexicon)
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17457
Vector Insertion
Chr 11: 104189285 - 104189502
Public Clones CMHD-GT_466G6-3 (cmhd)
Private Clones OST442476 (lexicon) OST102994 (lexicon) OST29295 (lexicon) OST23751 (lexicon)
OST19536 (lexicon) OST18069 (lexicon) OST10583 (lexicon) OST10490 (lexicon)
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106995
Sequence
CTCCAGCACCAGCAGCAGCGCCGCCGCCACCGCCCACCTTCTGCCGCCGCCGCCACAACCACCTTCTCCTCCGCTGTCCTCTTCTGTCCTCGCCTTCTGT

CGATTATCAG - UNI18971 - - UNI30181 - GCTTTGAACCAGTATGGCTGACCCTCGCCAGGAGTTTGACACAATGGAAGACCATGCTGGAGA

TTACACTCTGCTCCAAGACCAAGAAGGAGACATGGACCATGGCTTAAAAG - UNI11577 - - UNI18971 - - UNI27131 - - UNI30826

 - - UNI32535 - CCGAAGAAGCAGGCATCGGAGACACCCCGAACCAGGAGGACCAAGCCGCTGGGCATGTGACTCAAG - UNI11577 - - UN

I14237 - - UNI20720 - - UNI30785 - CTCGTGTGGCCAGCAAAGACAGGACAGGAAATGACGAGAAGAAAGCCAAG - UNI14800 - -

 UNI16863 - - UNI20720 - - UNI31333 - - UNI32177 - GGCGCTGATGGCAAAACCGGGGCGAAGATCGCCACACCTCGGGGAGCAG

CCTCTCCGGCCCAGAAGGGCACGTCCAACGCCACCAGGATCCCGGCCAAGACCACGCCCAGCCCTAAGACTCCTCCAGGGTCAG - UNI13141 - - 

UNI16863 - - UNI30541 - - UNI31128 - GTGAACCACCAAAATCCGGAGAACGAAGCGGCTACAGCAGCCCCGGCTCTCCCGGAACGCCTG

GCAGTCGCTCGCGCACCCCATCCCTACCAACACCGCCCACCCGGGAGCCCAAGAAGGTGGCAGTGGTCCGCACTCCCCCTAAGTCACCATCAGCTAGTAA

GAGCCGCCTGCAGACTGCCCCTGTGCCCATGCCAGACCTAAAGAATGTCAGGTCGAAGATTGGCTCTACTGAGAACCTGAAGCACCAGCCAGGAGGTGGC

AAG - UNI13054 - - UNI13141 - - UNI20978 - - UNI30920 - GTGCAAATAGTCTACAAGCCGGTGGACCTGAGCAAAGTGACCTC

CAAGTGTGGCTCGTTAGGGAACATCCATCACAAGCCAG - UNI4947 - - UNI13054 - - UNI24298 - GAGGTGGCCAGGTGGAAGTAAAA

TCAGAGAAGCTGGACTTCAAGGACAGAGTCCAGTCGAAGATTGGCTCCTTGGATAATATCACCCACGTCCCTGGAGGAGGGAATAAGAAG - UNI4947

 - - UNI17457 - - UNI25423 - ATTGAAACCCACAAGCTGACCTTCAGGGAGAATGCCAAAGCCAAGACAGACCATGGAGCAGAAATTGTGTA

TAAGTCACCCGTGGTGTCTGGGGACACATCTCCACGGCACCTCAGCAATGTGTCTTCCACGGGCAGCATCGACATGGTGGACTCACCACAGCTTGCCACA

CTAGCCGATGAAGTGTCTGCTTCCTTGGCCAAGCAGG - UNI17457 - GAAAAGCTGCTTTACTGAGTTCTCAAGTTTGGAACTACAGCCATGATTT

GGCCACCATTACAGACCTGGGACTTTAG
Translation
 - UNI18971 - - UNI30181 - MADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKA - UNI11577 - - UNI18971 - - UNI27131 -

 - UNI30826 - - UNI32535 - AEEAGIGDTPNQEDQAAGHVTQA - UNI11577 - - UNI14237 - - UNI20720 - - UNI30785

 - ARVASKDRTGNDEKKAK - UNI14800 - - UNI16863 - - UNI20720 - - UNI31333 - - UNI32177 - GADGKTGAKIATPR

GAASPAQKGTSNATRIPAKTTPSPKTPPGSG - UNI13141 - - UNI16863 - - UNI30541 - - UNI31128 - GEPPKSGERSGYSSPG

SPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSASKSRLQTAPVPMPDLKNVRSKIGSTENLKHQPGGGK - UNI13054 - - UNI13141 - 

- UNI20978 - - UNI30920 - VQIVYKPVDLSKVTSKCGSLGNIHHKPG - UNI4947 - - UNI13054 - - UNI24298 - GGGQVEV

KSEKLDFKDRVQSKIGSLDNITHVPGGGNKK - UNI4947 - - UNI17457 - - UNI25423 - IETHKLTFRENAKAKTDHGAEIVYKSPVVS

GDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQG - UNI17457 - GKAALLSSQVWNYSHDLATITDLGL
Transcript ENSMUST00000018555
Sequence
CTCCAGCACCAGCAGCAGCGCCGCCGCCACCGCCCACCTTCTGCCGCCGCCGCCACAACCACCTTCTCCTCCGCTGTCCTCTTCTGTCCTCGCCTTCTGT

CGATTATCAG - UNI18971 - - UNI30181 - GCTTTGAACCAGTATGGCTGACCCTCGCCAGGAGTTTGACACAATGGAAGACCATGCTGGAGA

TTACACTCTGCTCCAAGACCAAGAAGGAGACATGGACCATGGCTTAAAAG - UNI18971 - - UNI32535 - AGTCTCCCCCACAGCCCCCCGCC

GATGATGGAGCGGAGGAACCAGGGTCGGAGACCTCCGATGCTAAGAGCACTCCAACTGCTGAAG - UNI30826 - ACGTGACTGCGCCCCTAGTGGA

TGAGAGAGCTCCCGACAAGCAGGCCGCTGCCCAGCCCCACACGGAGATCCCAGAAGGAATTACAG - UNI11577 - - UNI27131 - CCGAAGAA

GCAGGCATCGGAGACACCCCGAACCAGGAGGACCAAGCCGCTGGGCATGTGACTCAAG - UNI11577 - - UNI30785 - AACCGGAGAAGGTCG

AGATTTTCTCACAAAGTTTGCTTGTCGAACCAGGGCGTCGTGAAGGCCAGGCCCCAGATTTGGGGACCTCAGACTGGACCCGCCAACAGGTGTCTAGCAT

GTCTGGGGCTCCCCTCCTGCCACAAGGCCTCAGAGAGGCTACATGTCAACCTTCGGGAACAAGACCTGAGGACATAGAGAAAAGCCACCCGGCCTCTGAG

CTGCTGCGGCGAGGGCCACCTCAGAAGGAAGGCTGGGGCCAAGACAGGCTGGGGAGTGAGGAAGAGGTGGATGAAGATCTCACCGTGGATGAATCATCCC

AGGATTCCCCTCCCTCCCAGGCCTCCCTGACCCCTGGCAGGGCAGCCCCTCAGGCCGGCTCCGGCTCTGTCTGCGGGGAGACCGCCAGCGTGCCTGGGCT

CCCAACTGAGGGTTCCGTCCCACTTCCTGCTGATTTCTTCTCCAAAGTCTCCGCAGAGACCCAGGCCTCACAGCCCGAAGGGCCTGGCACGGGGCCCATG

GAGGAAGGGCACGAGGCTGCCCCTGAGTTCACGTTCCACGTGGAAATCAAAGCCAGCACGCCGAAGGAACAGGATTTGGAAGGGGCTACAGTGGTGGGGG

TCCCCGGAGAGGAGCAAAAGGCCCAGACCCAGGGCCCCTCTGTGGGAAAGGGCACCAAAGAGGCTAGCCTTCAGGAACCTCCTGGCAAGCAACCTGCAGC

CGGCCTGCCCGGGAGGCCAGTCAGTCGGGTTCCTCAACTTAAAG - UNI14237 - - UNI20720 - CTCGTGTGGCCAGCAAAGACAGGACAGGA

AATGACGAGAAGAAAGCCAAG - UNI20720 - - UNI32177 - ACATCCACACCTTCCTGTGCTAAAGCCCCGAGCCATAGGCCCTGCCTTAGCC

CCACACGCCCCACTCTTGGTAGCTCAGACCCTTTGATCAAACCCTCCAGCCCTGCCGTGTGCCCTGAACCAGCCACCTCTCCTAAACACGTCTCTTCTGT

CACACCCCGAAATGGCAGTCCTGGAACAAAGCAGATGAAACTCAAG - UNI14800 - - UNI16863 - - UNI31333 - GGCGCTGATGGCAA

AACCGGGGCGAAGATCGCCACACCTCGGGGAGCAGCCTCTCCGGCCCAGAAGGGCACGTCCAACGCCACCAGGATCCCGGCCAAGACCACGCCCAGCCCT

AAGACTCCTCCAGGGTCAG - UNI13141 - - UNI16863 - - UNI30541 - - UNI31128 - GTGAACCACCAAAATCCGGAGAACGAAG

CGGCTACAGCAGCCCCGGCTCTCCCGGAACGCCTGGCAGTCGCTCGCGCACCCCATCCCTACCAACACCGCCCACCCGGGAGCCCAAGAAGGTGGCAGTG

GTCCGCACTCCCCCTAAGTCACCATCAGCTAGTAAGAGCCGCCTGCAGACTGCCCCTGTGCCCATGCCAGACCTAAAGAATGTCAGGTCGAAGATTGGCT

CTACTGAGAACCTGAAGCACCAGCCAGGAGGTGGCAAG - UNI13141 - - UNI30920 - GTGCAGATAATTAATAAGAAGCTGGATCTTAGCAA

CGTCCAGTCCAAGTGTGGCTCGAAGGATAATATCAAACACGTCCCGGGTGGAGGCAGT - UNI13054 - - UNI20978 - GTGCAAATAGTCTAC

AAGCCGGTGGACCTGAGCAAAGTGACCTCCAAGTGTGGCTCGTTAGGGAACATCCATCACAAGCCAG - UNI4947 - - UNI13054 - - UNI24

298 - GAGGTGGCCAGGTGGAAGTAAAATCAGAGAAGCTGGACTTCAAGGACAGAGTCCAGTCGAAGATTGGCTCCTTGGATAATATCACCCACGTCCC

TGGAGGAGGGAATAAGAAG - UNI4947 - - UNI17457 - - UNI25423 - ATTGAAACCCACAAGCTGACCTTCAGGGAGAATGCCAAAGCC

AAGACAGACCATGGAGCAGAAATTGTGTATAAGTCACCCGTGGTGTCTGGGGACACATCTCCACGGCACCTCAGCAATGTGTCTTCCACGGGCAGCATCG

ACATGGTGGACTCACCACAGCTTGCCACACTAGCCGATGAAGTGTCTGCTTCCTTGGCCAAGCAGGGTTTGTGATCAGGCTCCCAGGGCAGTCAATAATC

ATGGAGAGAAGAGAGAGTGAGAGTGTGG
Translation
 - UNI18971 - - UNI30181 - MADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKE - UNI18971 - - UNI32535 - ESPPQPPADDGA

EEPGSETSDAKSTPTAED - UNI30826 - DVTAPLVDERAPDKQAAAQPHTEIPEGITA - UNI11577 - - UNI27131 - AEEAGIGDTPN

QEDQAAGHVTQE - UNI11577 - - UNI30785 - EPEKVEIFSQSLLVEPGRREGQAPDLGTSDWTRQQVSSMSGAPLLPQGLREATCQPSGTRP

EDIEKSHPASELLRRGPPQKEGWGQDRLGSEEEVDEDLTVDESSQDSPPSQASLTPGRAAPQAGSGSVCGETASVPGLPTEGSVPLPADFFSKVSAETQA

SQPEGPGTGPMEEGHEAAPEFTFHVEIKASTPKEQDLEGATVVGVPGEEQKAQTQGPSVGKGTKEASLQEPPGKQPAAGLPGRPVSRVPQLKA - UNI1

4237 - - UNI20720 - ARVASKDRTGNDEKKAK - UNI20720 - - UNI32177 - TSTPSCAKAPSHRPCLSPTRPTLGSSDPLIKPSSPA

VCPEPATSPKHVSSVTPRNGSPGTKQMKLK - UNI14800 - - UNI16863 - - UNI31333 - GADGKTGAKIATPRGAASPAQKGTSNATRI

PAKTTPSPKTPPGSG - UNI13141 - - UNI16863 - - UNI30541 - - UNI31128 - GEPPKSGERSGYSSPGSPGTPGSRSRTPSLPT

PPTREPKKVAVVRTPPKSPSASKSRLQTAPVPMPDLKNVRSKIGSTENLKHQPGGGK - UNI13141 - - UNI30920 - VQIINKKLDLSNVQSK

CGSKDNIKHVPGGGS - UNI13054 - - UNI20978 - VQIVYKPVDLSKVTSKCGSLGNIHHKPG - UNI4947 - - UNI13054 - - UN

I24298 - GGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKK - UNI4947 - - UNI17457 - - UNI25423 - IETHKLTFRENAKA

KTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
Transcript ENSMUST00000100347
Sequence
CTCCAGCACCAGCAGCAGCGCCGCCGCCACCGCCCACCTTCTGCCGCCGCCGCCACAACCACCTTCTCCTCCGCTGTCCTCTTCTGTCCTCGCCTTCTGT

CGATTATCAG - UNI18971 - - UNI30181 - GCTTTGAACCAGTATGGCTGACCCTCGCCAGGAGTTTGACACAATGGAAGACCATGCTGGAGA

TTACACTCTGCTCCAAGACCAAGAAGGAGACATGGACCATGGCTTAAAAG - UNI18971 - - UNI32535 - AGTCTCCCCCACAGCCCCCCGCC

GATGATGGAGCGGAGGAACCAGGGTCGGAGACCTCCGATGCTAAGAGCACTCCAACTGCTGAAG - UNI30826 - ACGTGACTGCGCCCCTAGTGGA

TGAGAGAGCTCCCGACAAGCAGGCCGCTGCCCAGCCCCACACGGAGATCCCAGAAGGAATTACAG - UNI11577 - - UNI27131 - CCGAAGAA

GCAGGCATCGGAGACACCCCGAACCAGGAGGACCAAGCCGCTGGGCATGTGACTCAAG - UNI11577 - - UNI14237 - - UNI20720 - - 

UNI30785 - CTCGTGTGGCCAGCAAAGACAGGACAGGAAATGACGAGAAGAAAGCCAAG - UNI14800 - - UNI16863 - - UNI20720 -

 - UNI31333 - - UNI32177 - GGCGCTGATGGCAAAACCGGGGCGAAGATCGCCACACCTCGGGGAGCAGCCTCTCCGGCCCAGAAGGGCACGT

CCAACGCCACCAGGATCCCGGCCAAGACCACGCCCAGCCCTAAGACTCCTCCAGGGTCAG - UNI13141 - - UNI16863 - - UNI30541 - 

- UNI31128 - GTGAACCACCAAAATCCGGAGAACGAAGCGGCTACAGCAGCCCCGGCTCTCCCGGAACGCCTGGCAGTCGCTCGCGCACCCCATCCC

TACCAACACCGCCCACCCGGGAGCCCAAGAAGGTGGCAGTGGTCCGCACTCCCCCTAAGTCACCATCAGCTAGTAAGAGCCGCCTGCAGACTGCCCCTGT

GCCCATGCCAGACCTAAAGAATGTCAGGTCGAAGATTGGCTCTACTGAGAACCTGAAGCACCAGCCAGGAGGTGGCAAG - UNI13141 - - UNI30

920 - GTGCAGATAATTAATAAGAAGCTGGATCTTAGCAACGTCCAGTCCAAGTGTGGCTCGAAGGATAATATCAAACACGTCCCGGGTGGAGGCAGT 

- UNI13054 - - UNI20978 - GTGCAAATAGTCTACAAGCCGGTGGACCTGAGCAAAGTGACCTCCAAGTGTGGCTCGTTAGGGAACATCCATCA

CAAGCCAG - UNI4947 - - UNI13054 - - UNI24298 - GAGGTGGCCAGGTGGAAGTAAAATCAGAGAAGCTGGACTTCAAGGACAGAGTC

CAGTCGAAGATTGGCTCCTTGGATAATATCACCCACGTCCCTGGAGGAGGGAATAAGAAG - UNI4947 - - UNI17457 - - UNI25423 - A

TTGAAACCCACAAGCTGACCTTCAGGGAGAATGCCAAAGCCAAGACAGACCATGGAGCAGAAATTGTGTATAAGTCACCCGTGGTGTCTGGGGACACATC

TCCACGGCACCTCAGCAATGTGTCTTCCACGGGCAGCATCGACATGGTGGACTCACCACAGCTTGCCACACTAGCCGATGAAGTGTCTGCTTCCTTGGCC

AAGCAGGGTTTGTGATCAGGCTCCCAGGGCAGTCAATAATCATGGAGAGAAGAGAGAGTGAGAGTGTGG
Translation
 - UNI18971 - - UNI30181 - MADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKE - UNI18971 - - UNI32535 - ESPPQPPADDGA

EEPGSETSDAKSTPTAED - UNI30826 - DVTAPLVDERAPDKQAAAQPHTEIPEGITA - UNI11577 - - UNI27131 - AEEAGIGDTPN

QEDQAAGHVTQA - UNI11577 - - UNI14237 - - UNI20720 - - UNI30785 - ARVASKDRTGNDEKKAK - UNI14800 - - UN

I16863 - - UNI20720 - - UNI31333 - - UNI32177 - GADGKTGAKIATPRGAASPAQKGTSNATRIPAKTTPSPKTPPGSG - UNI1

3141 - - UNI16863 - - UNI30541 - - UNI31128 - GEPPKSGERSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSAS

KSRLQTAPVPMPDLKNVRSKIGSTENLKHQPGGGK - UNI13141 - - UNI30920 - VQIINKKLDLSNVQSKCGSKDNIKHVPGGGS - UNI1

3054 - - UNI20978 - VQIVYKPVDLSKVTSKCGSLGNIHHKPG - UNI4947 - - UNI13054 - - UNI24298 - GGGQVEVKSEKLD

FKDRVQSKIGSLDNITHVPGGGNKK - UNI4947 - - UNI17457 - - UNI25423 - IETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPR

HLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
Transcript ENSMUST00000106993
Sequence
CTCCAGCACCAGCAGCAGCGCCGCCGCCACCGCCCACCTTCTGCCGCCGCCGCCACAACCACCTTCTCCTCCGCTGTCCTCTTCTGTCCTCGCCTTCTGT

CGATTATCAG - UNI18971 - - UNI30181 - GCTTTGAACCAGTATGGCTGACCCTCGCCAGGAGTTTGACACAATGGAAGACCATGCTGGAGA

TTACACTCTGCTCCAAGACCAAGAAGGAGACATGGACCATGGCTTAAAAG - UNI11577 - - UNI18971 - - UNI27131 - - UNI30826

 - - UNI32535 - CCGAAGAAGCAGGCATCGGAGACACCCCGAACCAGGAGGACCAAGCCGCTGGGCATGTGACTCAAG - UNI11577 - - UN

I14237 - - UNI20720 - - UNI30785 - CTCGTGTGGCCAGCAAAGACAGGACAGGAAATGACGAGAAGAAAGCCAAG - UNI14800 - -

 UNI16863 - - UNI20720 - - UNI31333 - - UNI32177 - GGCGCTGATGGCAAAACCGGGGCGAAGATCGCCACACCTCGGGGAGCAG

CCTCTCCGGCCCAGAAGGGCACGTCCAACGCCACCAGGATCCCGGCCAAGACCACGCCCAGCCCTAAGACTCCTCCAGGGTCAG - UNI16863 - - 

UNI31128 - CTTCCAAGCAACCGCAGAGAAAACTACCCCCTGCAGGGGCAAAATCTGAGAGAG - UNI13141 - - UNI30541 - GTGAACCA

CCAAAATCCGGAGAACGAAGCGGCTACAGCAGCCCCGGCTCTCCCGGAACGCCTGGCAGTCGCTCGCGCACCCCATCCCTACCAACACCGCCCACCCGGG

AGCCCAAGAAGGTGGCAGTGGTCCGCACTCCCCCTAAGTCACCATCAGCTAGTAAGAGCCGCCTGCAGACTGCCCCTGTGCCCATGCCAGACCTAAAGAA

TGTCAGGTCGAAGATTGGCTCTACTGAGAACCTGAAGCACCAGCCAGGAGGTGGCAAG - UNI13141 - - UNI30920 - GTGCAGATAATTAAT

AAGAAGCTGGATCTTAGCAACGTCCAGTCCAAGTGTGGCTCGAAGGATAATATCAAACACGTCCCGGGTGGAGGCAGT - UNI13054 - - UNI209

78 - GTGCAAATAGTCTACAAGCCGGTGGACCTGAGCAAAGTGACCTCCAAGTGTGGCTCGTTAGGGAACATCCATCACAAGCCAG - UNI4947 - 

- UNI13054 - - UNI24298 - GAGGTGGCCAGGTGGAAGTAAAATCAGAGAAGCTGGACTTCAAGGACAGAGTCCAGTCGAAGATTGGCTCCTTG

GATAATATCACCCACGTCCCTGGAGGAGGGAATAAGAAG - UNI4947 - - UNI17457 - - UNI25423 - ATTGAAACCCACAAGCTGACCT

TCAGGGAGAATGCCAAAGCCAAGACAGACCATGGAGCAGAAATTGTGTATAAGTCACCCGTGGTGTCTGGGGACACATCTCCACGGCACCTCAGCAATGT

GTCTTCCACGGGCAGCATCGACATGGTGGACTCACCACAGCTTGCCACACTAGCCGATGAAGTGTCTGCTTCCTTGGCCAAGCAGGGTTTGTGATCAGGC

TCCCAGGGCAGTCAATAATCATGGAGAGAAGAGAGAGTGAGAGTGTGG
Translation
 - UNI18971 - - UNI30181 - MADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKA - UNI11577 - - UNI18971 - - UNI27131 -

 - UNI30826 - - UNI32535 - AEEAGIGDTPNQEDQAAGHVTQA - UNI11577 - - UNI14237 - - UNI20720 - - UNI30785

 - ARVASKDRTGNDEKKAK - UNI14800 - - UNI16863 - - UNI20720 - - UNI31333 - - UNI32177 - GADGKTGAKIATPR

GAASPAQKGTSNATRIPAKTTPSPKTPPGSA - UNI16863 - - UNI31128 - ASKQPQRKLPPAGAKSERG - UNI13141 - - UNI3054

1 - GEPPKSGERSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSASKSRLQTAPVPMPDLKNVRSKIGSTENLKHQPGGGK - UNI1

3141 - - UNI30920 - VQIINKKLDLSNVQSKCGSKDNIKHVPGGGS - UNI13054 - - UNI20978 - VQIVYKPVDLSKVTSKCGSLGN

IHHKPG - UNI4947 - - UNI13054 - - UNI24298 - GGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKK - UNI4947 - - UN

I17457 - - UNI25423 - IETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
Transcript ENSMUST00000106992
Sequence
CTCCAGCACCAGCAGCAGCGCCGCCGCCACCGCCCACCTTCTGCCGCCGCCGCCACAACCACCTTCTCCTCCGCTGTCCTCTTCTGTCCTCGCCTTCTGT

CGATTATCAG - UNI18971 - - UNI30181 - GCTTTGAACCAGTATGGCTGACCCTCGCCAGGAGTTTGACACAATGGAAGACCATGCTGGAGA

TTACACTCTGCTCCAAGACCAAGAAGGAGACATGGACCATGGCTTAAAAG - UNI11577 - - UNI18971 - - UNI27131 - - UNI30826

 - - UNI32535 - CCGAAGAAGCAGGCATCGGAGACACCCCGAACCAGGAGGACCAAGCCGCTGGGCATGTGACTCAAG - UNI11577 - - UN

I14237 - - UNI20720 - - UNI30785 - CTCGTGTGGCCAGCAAAGACAGGACAGGAAATGACGAGAAGAAAGCCAAG - UNI14800 - -

 UNI16863 - - UNI20720 - - UNI31333 - - UNI32177 - GGCGCTGATGGCAAAACCGGGGCGAAGATCGCCACACCTCGGGGAGCAG

CCTCTCCGGCCCAGAAGGGCACGTCCAACGCCACCAGGATCCCGGCCAAGACCACGCCCAGCCCTAAGACTCCTCCAGGGTCAG - UNI13141 - - 

UNI16863 - - UNI30541 - - UNI31128 - GTGAACCACCAAAATCCGGAGAACGAAGCGGCTACAGCAGCCCCGGCTCTCCCGGAACGCCTG

GCAGTCGCTCGCGCACCCCATCCCTACCAACACCGCCCACCCGGGAGCCCAAGAAGGTGGCAGTGGTCCGCACTCCCCCTAAGTCACCATCAGCTAGTAA

GAGCCGCCTGCAGACTGCCCCTGTGCCCATGCCAGACCTAAAGAATGTCAGGTCGAAGATTGGCTCTACTGAGAACCTGAAGCACCAGCCAGGAGGTGGC

AAG - UNI13141 - - UNI30920 - GTGCAGATAATTAATAAGAAGCTGGATCTTAGCAACGTCCAGTCCAAGTGTGGCTCGAAGGATAATATCA

AACACGTCCCGGGTGGAGGCAGT - UNI13054 - - UNI20978 - GTGCAAATAGTCTACAAGCCGGTGGACCTGAGCAAAGTGACCTCCAAGTG

TGGCTCGTTAGGGAACATCCATCACAAGCCAG - UNI4947 - - UNI13054 - - UNI24298 - GAGGTGGCCAGGTGGAAGTAAAATCAGAG

AAGCTGGACTTCAAGGACAGAGTCCAGTCGAAGATTGGCTCCTTGGATAATATCACCCACGTCCCTGGAGGAGGGAATAAGAAG - UNI4947 - - U

NI17457 - - UNI25423 - ATTGAAACCCACAAGCTGACCTTCAGGGAGAATGCCAAAGCCAAGACAGACCATGGAGCAGAAATTGTGTATAAGTC

ACCCGTGGTGTCTGGGGACACATCTCCACGGCACCTCAGCAATGTGTCTTCCACGGGCAGCATCGACATGGTGGACTCACCACAGCTTGCCACACTAGCC

GATGAAGTGTCTGCTTCCTTGGCCAAGCAGGGTTTGTGATCAGGCTCCCAGGGCAGTCAATAATCATGGAGAGAAGAGAGAGTGAGAGTGTGG
Translation
 - UNI18971 - - UNI30181 - MADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKA - UNI11577 - - UNI18971 - - UNI27131 -

 - UNI30826 - - UNI32535 - AEEAGIGDTPNQEDQAAGHVTQA - UNI11577 - - UNI14237 - - UNI20720 - - UNI30785

 - ARVASKDRTGNDEKKAK - UNI14800 - - UNI16863 - - UNI20720 - - UNI31333 - - UNI32177 - GADGKTGAKIATPR

GAASPAQKGTSNATRIPAKTTPSPKTPPGSG - UNI13141 - - UNI16863 - - UNI30541 - - UNI31128 - GEPPKSGERSGYSSPG

SPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSASKSRLQTAPVPMPDLKNVRSKIGSTENLKHQPGGGK - UNI13141 - - UNI30920 - 

VQIINKKLDLSNVQSKCGSKDNIKHVPGGGS - UNI13054 - - UNI20978 - VQIVYKPVDLSKVTSKCGSLGNIHHKPG - UNI4947 - -

 UNI13054 - - UNI24298 - GGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKK - UNI4947 - - UNI17457 - - UNI25423 

- IETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
Transcript ENSMUST00000106991
Sequence
CTCCAGCACCAGCAGCAGCGCCGCCGCCACCGCCCACCTTCTGCCGCCGCCGCCACAACCACCTTCTCCTCCGCTGTCCTCTTCTGTCCTCGCCTTCTGT

CGATTATCAG - UNI18971 - - UNI30181 - GCTTTGAACCAGTATGGCTGACCCTCGCCAGGAGTTTGACACAATGGAAGACCATGCTGGAGA

TTACACTCTGCTCCAAGACCAAGAAGGAGACATGGACCATGGCTTAAAAG - UNI11577 - - UNI14237 - - UNI18971 - - UNI20720

 - - UNI27131 - - UNI30785 - - UNI30826 - - UNI32535 - CTCGTGTGGCCAGCAAAGACAGGACAGGAAATGACGAGAAGAAAG

CCAAG - UNI14800 - - UNI16863 - - UNI20720 - - UNI31333 - - UNI32177 - GGCGCTGATGGCAAAACCGGGGCGAAGAT

CGCCACACCTCGGGGAGCAGCCTCTCCGGCCCAGAAGGGCACGTCCAACGCCACCAGGATCCCGGCCAAGACCACGCCCAGCCCTAAGACTCCTCCAGGG

TCAG - UNI13141 - - UNI16863 - - UNI30541 - - UNI31128 - GTGAACCACCAAAATCCGGAGAACGAAGCGGCTACAGCAGCCC

CGGCTCTCCCGGAACGCCTGGCAGTCGCTCGCGCACCCCATCCCTACCAACACCGCCCACCCGGGAGCCCAAGAAGGTGGCAGTGGTCCGCACTCCCCCT

AAGTCACCATCAGCTAGTAAGAGCCGCCTGCAGACTGCCCCTGTGCCCATGCCAGACCTAAAGAATGTCAGGTCGAAGATTGGCTCTACTGAGAACCTGA

AGCACCAGCCAGGAGGTGGCAAG - UNI13141 - - UNI30920 - GTGCAGATAATTAATAAGAAGCTGGATCTTAGCAACGTCCAGTCCAAGTG

TGGCTCGAAGGATAATATCAAACACGTCCCGGGTGGAGGCAGT - UNI13054 - - UNI20978 - GTGCAAATAGTCTACAAGCCGGTGGACCTG

AGCAAAGTGACCTCCAAGTGTGGCTCGTTAGGGAACATCCATCACAAGCCAG - UNI4947 - - UNI13054 - - UNI24298 - GAGGTGGCC

AGGTGGAAGTAAAATCAGAGAAGCTGGACTTCAAGGACAGAGTCCAGTCGAAGATTGGCTCCTTGGATAATATCACCCACGTCCCTGGAGGAGGGAATAA

GAAG - UNI4947 - - UNI17457 - - UNI25423 - ATTGAAACCCACAAGCTGACCTTCAGGGAGAATGCCAAAGCCAAGACAGACCATGGA

GCAGAAATTGTGTATAAGTCACCCGTGGTGTCTGGGGACACATCTCCACGGCACCTCAGCAATGTGTCTTCCACGGGCAGCATCGACATGGTGGACTCAC

CACAGCTTGCCACACTAGCCGATGAAGTGTCTGCTTCCTTGGCCAAGCAGGGTTTGTGATCAGGCTCCCAGGGCAGTCAATAATCATGGAGAGAAGAGAG

AGTGAGAGTGTGG
Translation
 - UNI18971 - - UNI30181 - MADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKA - UNI11577 - - UNI14237 - - UNI18971 -

 - UNI20720 - - UNI27131 - - UNI30785 - - UNI30826 - - UNI32535 - ARVASKDRTGNDEKKAK - UNI14800 - - U

NI16863 - - UNI20720 - - UNI31333 - - UNI32177 - GADGKTGAKIATPRGAASPAQKGTSNATRIPAKTTPSPKTPPGSG - UNI

13141 - - UNI16863 - - UNI30541 - - UNI31128 - GEPPKSGERSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSA

SKSRLQTAPVPMPDLKNVRSKIGSTENLKHQPGGGK - UNI13141 - - UNI30920 - VQIINKKLDLSNVQSKCGSKDNIKHVPGGGS - UNI

13054 - - UNI20978 - VQIVYKPVDLSKVTSKCGSLGNIHHKPG - UNI4947 - - UNI13054 - - UNI24298 - GGGQVEVKSEKL

DFKDRVQSKIGSLDNITHVPGGGNKK - UNI4947 - - UNI17457 - - UNI25423 - IETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSP

RHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
Transcript ENSMUST00000106988
Sequence
ATGGCTGACCCTCGCCAGGAGTTTGACACAATGGAAGACCATGCTGGAGATTACACTCTGCTCCAAGACCAAGAAGGAGACATGGACCATGGCTTAAAAG

 - UNI18971 - - UNI32535 - AGTCTCCCCCACAGCCCCCCGCCGATGATGGAGCGGAGGAACCAGGGTCGGAGACCTCCGATGCTAAGAGCAC

TCCAACTGCTGAAG - UNI30826 - ACGTGACTGCGCCCCTAGTGGATGAGAGAGCTCCCGACAAGCAGGCCGCTGCCCAGCCCCACACGGAGATCC

CAGAAGGAATTACAG - UNI11577 - - UNI27131 - CCGAAGAAGCAGGCATCGGAGACACCCCGAACCAGGAGGACCAAGCCGCTGGGCATGT

GACTCAAG - UNI11577 - - UNI30785 - GGCGTCGTGAAGGCCAGGCCCCAGATTTGGGGACCTCAGACTGGACCCGCCAACAGGTGTCTAGC

ATGTCTGGGGCTCCCCTCCTGCCACAAGGCCTCAGAGAGGCTACATGTCAACCTTCGGGAACAAGACCTGAGGACATAGAGAAAAGCCACCCGGCCTCTG

AGCTGCTGCGGCGAGGGCCACCTCAGAAGGAAGGCTGGGGCCAAGACAGGCTGGGGAGTGAGGAAGAGGTGGATGAAGATCTCACCGTGGATGAATCATC

CCAGGATTCCCCTCCCTCCCAGGCCTCCCTGACCCCTGGCAGGGCAGCCCCTCAGGCCGGCTCCGGCTCTGTCTGCGGGGAGACCGCCAGCGTGCCTGGG

CTCCCAACTGAGGGTTCCGTCCCACTTCCTGCTGATTTCTTCTCCAAAGTCTCCGCAGAGACCCAGGCCTCACAGCCCGAAGGGCCTGGCACGGGGCCCA

TGGAGGAAGGGCACGAGGCTGCCCCTGAGTTCACGTTCCACGTGGAAATCAAAGCCAGCACGCCGAAGGAACAGGATTTGGAAGGGGCTACAGTGGTGGG

GGTCCCCGGAGAGGAGCAAAAGGCCCAGACCCAGGGCCCCTCTGTGGGAAAGGGCACCAAAGAGGCTAGCCTTCAGGAACCTCCTGGCAAGCAACCTGCA

GCCGGCCTGCCCGGGAGGCCAGTCAGTCGGGTTCCTCAACTTAAAG - UNI14237 - - UNI20720 - CTCGTGTGGCCAGCAAAGACAGGACAG

GAAATGACGAGAAGAAAGCCAAG - UNI20720 - - UNI32177 - ACATCCACACCTTCCTGTGCTAAAGCCCCGAGCCATAGGCCCTGCCTTAG

CCCCACACGCCCCACTCTTGGTAGCTCAGACCCTTTGATCAAACCCTCCAGCCCTGCCGTGTGCCCTGAACCAGCCACCTCTCCTAAACACGTCTCTTCT

GTCACACCCCGAAATGGCAGTCCTGGAACAAAGCAGATGAAACTCAAG - UNI14800 - - UNI16863 - - UNI31333 - GGCGCTGATGGC

AAAACCGGGGCGAAGATCGCCACACCTCGGGGAGCAGCCTCTCCGGCCCAGAAGGGCACGTCCAACGCCACCAGGATCCCGGCCAAGACCACGCCCAGCC

CTAAGACTCCTCCAGGGTCAG - UNI13141 - - UNI16863 - - UNI30541 - - UNI31128 - GTGAACCACCAAAATCCGGAGAACGA

AGCGGCTACAGCAGCCCCGGCTCTCCCGGAACGCCTGGCAGTCGCTCGCGCACCCCATCCCTACCAACACCGCCCACCCGGGAGCCCAAGAAGGTGGCAG

TGGTCCGCACTCCCCCTAAGTCACCATCAGCTAGTAAGAGCCGCCTGCAGACTGCCCCTGTGCCCATGCCAGACCTAAAGAATGTCAGGTCGAAGATTGG

CTCTACTGAGAACCTGAAGCACCAGCCAGGAGGTGGCAAG - UNI13141 - - UNI30920 - GTGCAGATAATTAATAAGAAGCTGGATCTTAGC

AACGTCCAGTCCAAGTGTGGCTCGAAGGATAATATCAAACACGTCCCGGGTGGAGGCAGT - UNI13054 - - UNI20978 - GTGCAAATAGTCT

ACAAGCCGGTGGACCTGAGCAAAGTGACCTCCAAGTGTGGCTCGTTAGGGAACATCCATCACAAGCCAG - UNI4947 - - UNI13054 - - UNI

24298 - GAGGTGGCCAGGTGGAAGTAAAATCAGAGAAGCTGGACTTCAAGGACAGAGTCCAGTCGAAGATTGGCTCCTTGGATAATATCACCCACGTC

CCTGGAGGAGGGAATAAGAAG - UNI4947 - - UNI17457 - - UNI25423 - ATTGAAACCCACAAGCTGACCTTCAGGGAGAATGCCAAAG

CCAAGACAGACCATGGAGCAGAAATTGTGTATAAGTCACCCGTGGTGTCTGGGGACACATCTCCACGGCACCTCAGCAATGTGTCTTCCACGGGCAGCAT

CGACATGGTGGACTCACCACAGCTTGCCACACTAGCCGATGAAGTGTCTGCTTCCTTGGCCAAGCAGGGTTTGTGA
Translation
MADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKE - UNI18971 - - UNI32535 - ESPPQPPADDGAEEPGSETSDAKSTPTAED - UNI308

26 - DVTAPLVDERAPDKQAAAQPHTEIPEGITA - UNI11577 - - UNI27131 - AEEAGIGDTPNQEDQAAGHVTQG - UNI11577 - -

 UNI30785 - GRREGQAPDLGTSDWTRQQVSSMSGAPLLPQGLREATCQPSGTRPEDIEKSHPASELLRRGPPQKEGWGQDRLGSEEEVDEDLTVDES

SQDSPPSQASLTPGRAAPQAGSGSVCGETASVPGLPTEGSVPLPADFFSKVSAETQASQPEGPGTGPMEEGHEAAPEFTFHVEIKASTPKEQDLEGATVV

GVPGEEQKAQTQGPSVGKGTKEASLQEPPGKQPAAGLPGRPVSRVPQLKA - UNI14237 - - UNI20720 - ARVASKDRTGNDEKKAK - UNI

20720 - - UNI32177 - TSTPSCAKAPSHRPCLSPTRPTLGSSDPLIKPSSPAVCPEPATSPKHVSSVTPRNGSPGTKQMKLK - UNI14800 -

 - UNI16863 - - UNI31333 - GADGKTGAKIATPRGAASPAQKGTSNATRIPAKTTPSPKTPPGSG - UNI13141 - - UNI16863 - -

 UNI30541 - - UNI31128 - GEPPKSGERSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSASKSRLQTAPVPMPDLKNVRSKI

GSTENLKHQPGGGK - UNI13141 - - UNI30920 - VQIINKKLDLSNVQSKCGSKDNIKHVPGGGS - UNI13054 - - UNI20978 - V

QIVYKPVDLSKVTSKCGSLGNIHHKPG - UNI4947 - - UNI13054 - - UNI24298 - GGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGG

GNKK - UNI4947 - - UNI17457 - - UNI25423 - IETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLAT

LADEVSASLAKQGL
Transcript ENSMUST00000106989
Sequence
ATGGCTGACCCTCGCCAGGAGTTTGACACAATGGAAGACCATGCTGGAGATTACACTCTGCTCCAAGACCAAGAAGGAGACATGGACCATGGCTTAAAAG

 - UNI18971 - - UNI32535 - AGTCTCCCCCACAGCCCCCCGCCGATGATGGAGCGGAGGAACCAGGGTCGGAGACCTCCGATGCTAAGAGCAC

TCCAACTGCTGAAG - UNI30826 - ACGTGACTGCGCCCCTAGTGGATGAGAGAGCTCCCGACAAGCAGGCCGCTGCCCAGCCCCACACGGAGATCC

CAGAAGGAATTACAG - UNI11577 - - UNI27131 - CCGAAGAAGCAGGCATCGGAGACACCCCGAACCAGGAGGACCAAGCCGCTGGGCATGT

GACTCAAG - UNI11577 - - UNI30785 - AACCGGAGAAGGTCGAGATTTTCTCACAAAGTTTGCTTGTCGAACCAGGGCGTCGTGAAGGCCAG

GCCCCAGATTTGGGGACCTCAGACTGGACCCGCCAACAGGTGTCTAGCATGTCTGGGGCTCCCCTCCTGCCACAAGGCCTCAGAGAGGCTACATGTCAAC

CTTCGGGAACAAGACCTGAGGACATAGAGAAAAGCCACCCGGCCTCTGAGCTGCTGCGGCGAGGGCCACCTCAGAAGGAAGGCTGGGGCCAAGACAGGCT

GGGGAGTGAGGAAGAGGTGGATGAAGATCTCACCGTGGATGAATCATCCCAGGATTCCCCTCCCTCCCAGGCCTCCCTGACCCCTGGCAGGGCAGCCCCT

CAGGCCGGCTCCGGCTCTGTCTGCGGGGAGACCGCCAGCGTGCCTGGGCTCCCAACTGAGGGTTCCGTCCCACTTCCTGCTGATTTCTTCTCCAAAGTCT

CCGCAGAGACCCAGGCCTCACAGCCCGAAGGGCCTGGCACGGGGCCCATGGAGGAAGGGCACGAGGCTGCCCCTGAGTTCACGTTCCACGTGGAAATCAA

AGCCAGCACGCCGAAGGAACAGGATTTGGAAGGGGCTACAGTGGTGGGGGTCCCCGGAGAGGAGCAAAAGGCCCAGACCCAGGGCCCCTCTGTGGGAAAG

GGCACCAAAGAGGCTAGCCTTCAGGAACCTCCTGGCAAGCAACCTGCAGCCGGCCTGCCCGGGAGGCCAGTCAGTCGGGTTCCTCAACTTAAAG - UNI

14237 - - UNI20720 - CTCGTGTGGCCAGCAAAGACAGGACAGGAAATGACGAGAAGAAAGCCAAG - UNI20720 - - UNI32177 - AC

ATCCACACCTTCCTGTGCTAAAGCCCCGAGCCATAGGCCCTGCCTTAGCCCCACACGCCCCACTCTTGGTAGCTCAGACCCTTTGATCAAACCCTCCAGC

CCTGCCGTGTGCCCTGAACCAGCCACCTCTCCTAAACACGTCTCTTCTGTCACACCCCGAAATGGCAGTCCTGGAACAAAGCAGATGAAACTCAAG - U

NI14800 - - UNI16863 - - UNI31333 - GGCGCTGATGGCAAAACCGGGGCGAAGATCGCCACACCTCGGGGAGCAGCCTCTCCGGCCCAGA

AGGGCACGTCCAACGCCACCAGGATCCCGGCCAAGACCACGCCCAGCCCTAAGACTCCTCCAGGGTCAG - UNI13141 - - UNI16863 - - UN

I30541 - - UNI31128 - GTGAACCACCAAAATCCGGAGAACGAAGCGGCTACAGCAGCCCCGGCTCTCCCGGAACGCCTGGCAGTCGCTCGCGCA

CCCCATCCCTACCAACACCGCCCACCCGGGAGCCCAAGAAGGTGGCAGTGGTCCGCACTCCCCCTAAGTCACCATCAGCTAGTAAGAGCCGCCTGCAGAC

TGCCCCTGTGCCCATGCCAGACCTAAAGAATGTCAGGTCGAAGATTGGCTCTACTGAGAACCTGAAGCACCAGCCAGGAGGTGGCAAG - UNI13141 

- - UNI30920 - GTGCAGATAATTAATAAGAAGCTGGATCTTAGCAACGTCCAGTCCAAGTGTGGCTCGAAGGATAATATCAAACACGTCCCGGGTG

GAGGCAGT - UNI13054 - - UNI20978 - GTGCAAATAGTCTACAAGCCGGTGGACCTGAGCAAAGTGACCTCCAAGTGTGGCTCGTTAGGGAA

CATCCATCACAAGCCAG - UNI4947 - - UNI13054 - - UNI24298 - GAGGTGGCCAGGTGGAAGTAAAATCAGAGAAGCTGGACTTCAAG

GACAGAGTCCAGTCGAAGATTGGCTCCTTGGATAATATCACCCACGTCCCTGGAGGAGGGAATAAGAAG - UNI4947 - - UNI17457 - - UNI

25423 - ATTGAAACCCACAAGCTGACCTTCAGGGAGAATGCCAAAGCCAAGACAGACCATGGAGCAGAAATTGTGTATAAGTCACCCGTGGTGTCTGG

GGACACATCTCCACGGCACCTCAGCAATGTGTCTTCCACGGGCAGCATCGACATGGTGGACTCACCACAGCTTGCCACACTAGCCGATGAAGTGTCTGCT

TCCTTGGCCAAGCAGGGTTTGTGA
Translation
MADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKE - UNI18971 - - UNI32535 - ESPPQPPADDGAEEPGSETSDAKSTPTAED - UNI308

26 - DVTAPLVDERAPDKQAAAQPHTEIPEGITA - UNI11577 - - UNI27131 - AEEAGIGDTPNQEDQAAGHVTQE - UNI11577 - -

 UNI30785 - EPEKVEIFSQSLLVEPGRREGQAPDLGTSDWTRQQVSSMSGAPLLPQGLREATCQPSGTRPEDIEKSHPASELLRRGPPQKEGWGQDR

LGSEEEVDEDLTVDESSQDSPPSQASLTPGRAAPQAGSGSVCGETASVPGLPTEGSVPLPADFFSKVSAETQASQPEGPGTGPMEEGHEAAPEFTFHVEI

KASTPKEQDLEGATVVGVPGEEQKAQTQGPSVGKGTKEASLQEPPGKQPAAGLPGRPVSRVPQLKA - UNI14237 - - UNI20720 - ARVASKD

RTGNDEKKAK - UNI20720 - - UNI32177 - TSTPSCAKAPSHRPCLSPTRPTLGSSDPLIKPSSPAVCPEPATSPKHVSSVTPRNGSPGTKQM

KLK - UNI14800 - - UNI16863 - - UNI31333 - GADGKTGAKIATPRGAASPAQKGTSNATRIPAKTTPSPKTPPGSG - UNI13141 

- - UNI16863 - - UNI30541 - - UNI31128 - GEPPKSGERSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSASKSRLQ

TAPVPMPDLKNVRSKIGSTENLKHQPGGGK - UNI13141 - - UNI30920 - VQIINKKLDLSNVQSKCGSKDNIKHVPGGGS - UNI13054 

- - UNI20978 - VQIVYKPVDLSKVTSKCGSLGNIHHKPG - UNI4947 - - UNI13054 - - UNI24298 - GGGQVEVKSEKLDFKDRV

QSKIGSLDNITHVPGGGNKK - UNI4947 - - UNI17457 - - UNI25423 - IETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNV

SSTGSIDMVDSPQLATLADEVSASLAKQGL
Transcript ENSMUST00000106987
Sequence
CTCCAGCACCAGCAGCAGCGCCGCCGCCACCGCCCACCTTCTGCCGCCGCCGCCACAACCACCTTCTCCTCCGCTGTCCTCTTCTGTCCTCGCCTTCTGT

CGATTATCAG - UNI18971 - - UNI30181 - GCTTTGAACCAGTATGGCTGACCCTCGCCAGGAGTTTGACACAATGGAAGACCATGCTGGAGA

TTACACTCTGCTCCAAGACCAAGAAGGAGACATGGACCATGGCTTAAAAG - UNI18971 - - UNI32535 - AGTCTCCCCCACAGCCCCCCGCC

GATGATGGAGCGGAGGAACCAGGGTCGGAGACCTCCGATGCTAAGAGCACTCCAACTGCTGAAG - UNI11577 - - UNI14237 - - UNI2072

0 - - UNI27131 - - UNI30785 - - UNI30826 - CTCGTGTGGCCAGCAAAGACAGGACAGGAAATGACGAGAAGAAAGCCAAG - UNI1

4800 - - UNI16863 - - UNI20720 - - UNI31333 - - UNI32177 - GGCGCTGATGGCAAAACCGGGGCGAAGATCGCCACACCTCG

GGGAGCAGCCTCTCCGGCCCAGAAGGGCACGTCCAACGCCACCAGGATCCCGGCCAAGACCACGCCCAGCCCTAAGACTCCTCCAGGGTCAG - UNI13

141 - - UNI16863 - - UNI30541 - - UNI31128 - GTGAACCACCAAAATCCGGAGAACGAAGCGGCTACAGCAGCCCCGGCTCTCCCGG

AACGCCTGGCAGTCGCTCGCGCACCCCATCCCTACCAACACCGCCCACCCGGGAGCCCAAGAAGGTGGCAGTGGTCCGCACTCCCCCTAAGTCACCATCA

GCTAGTAAGAGCCGCCTGCAGACTGCCCCTGTGCCCATGCCAGACCTAAAGAATGTCAGGTCGAAGATTGGCTCTACTGAGAACCTGAAGCACCAGCCAG

GAGGTGGCAAG - UNI13141 - - UNI30920 - GTGCAGATAATTAATAAGAAGCTGGATCTTAGCAACGTCCAGTCCAAGTGTGGCTCGAAGGA

TAATATCAAACACGTCCCGGGTGGAGGCAGT - UNI13054 - - UNI20978 - GTGCAAATAGTCTACAAGCCGGTGGACCTGAGCAAAGTGACC

TCCAAGTGTGGCTCGTTAGGGAACATCCATCACAAGCCAG - UNI4947 - - UNI13054 - - UNI24298 - GAGGTGGCCAGGTGGAAGTAA

AATCAGAGAAGCTGGACTTCAAGGACAGAGTCCAGTCGAAGATTGGCTCCTTGGATAATATCACCCACGTCCCTGGAGGAGGGAATAAGAAG - UNI49

47 - - UNI17457 - - UNI25423 - ATTGAAACCCACAAGCTGACCTTCAGGGAGAATGCCAAAGCCAAGACAGACCATGGAGCAGAAATTGTG

TATAAGTCACCCGTGGTGTCTGGGGACACATCTCCACGGCACCTCAGCAATGTGTCTTCCACGGGCAGCATCGACATGGTGGACTCACCACAGCTTGCCA

CACTAGCCGATGAAGTGTCTGCTTCCTTGGCCAAGCAGGGTTTGTGATCAGGCTCCCAGGGCAGTCAATAATCATGGAGAGAAGAGAGAGTGAGAGTGTG

G
Translation
 - UNI18971 - - UNI30181 - MADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKE - UNI18971 - - UNI32535 - ESPPQPPADDGA

EEPGSETSDAKSTPTAEA - UNI11577 - - UNI14237 - - UNI20720 - - UNI27131 - - UNI30785 - - UNI30826 - ARV

ASKDRTGNDEKKAK - UNI14800 - - UNI16863 - - UNI20720 - - UNI31333 - - UNI32177 - GADGKTGAKIATPRGAASPA

QKGTSNATRIPAKTTPSPKTPPGS - UNI13141 - - UNI16863 - - UNI30541 - - UNI31128 -  - UNI13141 - - UNI3092

0 -  - UNI13054 - - UNI20978 -  - UNI4947 - - UNI13054 - - UNI24298 -  - UNI4947 - - UNI17457 - - UN

I25423 - 
Transcript ENSMUST00000078906
Sequence
CTCCAGCACCAGCAGCAGCGCCGCCGCCACCGCCCACCTTCTGCCGCCGCCGCCACAACCACCTTCTCCTCCGCTGTCCTCTTCTGTCCTCGCCTTCTGT

CGATTATCAG - UNI18971 - - UNI30181 - GCTTTGAACCAGTATGGCTGACCCTCGCCAGGAGTTTGACACAATGGAAGACCATGCTGGAGA

TTACACTCTGCTCCAAGACCAAGAAGGAGACATGGACCATGGCTTAAAAG - UNI18971 - - UNI32535 - AGTCTCCCCCACAGCCCCCCGCC

GATGATGGAGCGGAGGAACCAGGGTCGGAGACCTCCGATGCTAAGAGCACTCCAACTGCTGAAG - UNI11577 - - UNI27131 - - UNI3082

6 - CCGAAGAAGCAGGCATCGGAGACACCCCGAACCAGGAGGACCAAGCCGCTGGGCATGTGACTCAAG - UNI11577 - - UNI14237 - - U

NI20720 - - UNI30785 - CTCGTGTGGCCAGCAAAGACAGGACAGGAAATGACGAGAAGAAAGCCAAG - UNI14800 - - UNI16863 - 

- UNI20720 - - UNI31333 - - UNI32177 - GGCGCTGATGGCAAAACCGGGGCGAAGATCGCCACACCTCGGGGAGCAGCCTCTCCGGCCC

AGAAGGGCACGTCCAACGCCACCAGGATCCCGGCCAAGACCACGCCCAGCCCTAAGACTCCTCCAGGGTCAG - UNI13141 - - UNI16863 - -

 UNI30541 - - UNI31128 - GTGAACCACCAAAATCCGGAGAACGAAGCGGCTACAGCAGCCCCGGCTCTCCCGGAACGCCTGGCAGTCGCTCGC

GCACCCCATCCCTACCAACACCGCCCACCCGGGAGCCCAAGAAGGTGGCAGTGGTCCGCACTCCCCCTAAGTCACCATCAGCTAGTAAGAGCCGCCTGCA

GACTGCCCCTGTGCCCATGCCAGACCTAAAGAATGTCAGGTCGAAGATTGGCTCTACTGAGAACCTGAAGCACCAGCCAGGAGGTGGCAAG - UNI131

41 - - UNI30920 - GTGCAGATAATTAATAAGAAGCTGGATCTTAGCAACGTCCAGTCCAAGTGTGGCTCGAAGGATAATATCAAACACGTCCCGG

GTGGAGGCAGT - UNI13054 - - UNI20978 - GTGCAAATAGTCTACAAGCCGGTGGACCTGAGCAAAGTGACCTCCAAGTGTGGCTCGTTAGG

GAACATCCATCACAAGCCAG - UNI4947 - - UNI13054 - - UNI24298 - GAGGTGGCCAGGTGGAAGTAAAATCAGAGAAGCTGGACTTC

AAGGACAGAGTCCAGTCGAAGATTGGCTCCTTGGATAATATCACCCACGTCCCTGGAGGAGGGAATAAGAAG - UNI4947 - - UNI17457 - - 

UNI25423 - ATTGAAACCCACAAGCTGACCTTCAGGGAGAATGCCAAAGCCAAGACAGACCATGGAGCAGAAATTGTGTATAAGTCACCCGTGGTGTC

TGGGGACACATCTCCACGGCACCTCAGCAATGTGTCTTCCACGGGCAGCATCGACATGGTGGACTCACCACAGCTTGCCACACTAGCCGATGAAGTGTCT

GCTTCCTTGGCCAAGCAGGGTTTGTGATCAGGCTCCCAGGGCAGTCAATAATCATGGAGAGAAGAGAGAGTGAGAGTGTGG
Translation
 - UNI18971 - - UNI30181 - MADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKE - UNI18971 - - UNI32535 - ESPPQPPADDGA

EEPGSETSDAKSTPTAEA - UNI11577 - - UNI27131 - - UNI30826 - AEEAGIGDTPNQEDQAAGHVTQ - UNI11577 - - UNI1

4237 - - UNI20720 - - UNI30785 -  - UNI14800 - - UNI16863 - - UNI20720 - - UNI31333 - - UNI32177 -  

- UNI13141 - - UNI16863 - - UNI30541 - - UNI31128 -  - UNI13141 - - UNI30920 -  - UNI13054 - - UNI20

978 -  - UNI4947 - - UNI13054 - - UNI24298 -  - UNI4947 - - UNI17457 - - UNI25423 - 

For any suggestions or comments, please send an email to unitrap@crg.es