Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000018425 (Dhx40)
Chromosomal location
Chr 11: 86583256 - 86621108 (-)
Description
DEAH (Asp-Glu-Ala-His) box polypeptide 40 Gene [Source:MGI (curated);Acc:Dhx40-001]
RefSeq_dna
NM_026191 
RefSeq_peptide
NP_080467.3 
UniGene
Mm.260627 
MGI
MGI:1914737 
Uniprot/SWISSPROT
Q6PE54 
Uniprot/SPTREMBL
Q5SXR4 
Human Ortholog
ENSG00000108406 (DHX40)
Omim not available
UniTrap UNI3315
Vector Insertion
Chr 11: 86614591 - 86617758
Public Clones AD0249 (sanger) IST12508A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5060
Vector Insertion
Chr 11: 86612921 - 86613150
Public Clones YTC747 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12698
Vector Insertion
Chr 11: 86611257 - 86612423
Public Clones YTC833 (baygenomics) F026A01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33725
Vector Insertion
Chr 11: 86606663 - 86611257
Public Clones IST11492H8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33714
Vector Insertion
Chr 11: 86599258 - 86602852
Public Clones IST11151B4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6310
Vector Insertion
Chr 11: 86590232 - 86598380
Public Clones CSD329 (baygenomics) CMHD-GT_473B5-3 (cmhd) CMHD-GT_452H3-3 (cmhd) IST10379D12 (tigm)
IST12681C11 (tigm) IST10144B7 (tigm) IST11254A5 (tigm) IST10455F9 (tigm)
IST10250H11 (tigm) IST10041D5HMF1 (tigm) IST12331B2 (tigm) IST12566A6 (tigm)
IST10479G7 (tigm) IST10703C7 (tigm) IST10442E1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33546
Vector Insertion
Chr 11: 86587305 - 86589271
Public Clones IST12528E5 (tigm) IST12527B7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34765
Vector Insertion
Chr 11: 86585395 - 86587401
Public Clones IST12822H9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000018569
Sequence
TCCCCTCCCATCTCCTCGGCTCCGTGGACGTGTTCGCTTCTTCTCCGGACCGGGTCTATGTCCCGGTTTCCCGCCGTCGCGGGCAGGGCGCCAAGGCGGC

AGGAGGAAGGCGAGCGGCCAATAGAGCTCCAGGAAGAGCGGCCGTCAGCTGTTCGCATCGCTGACAGAG AAGAGAAAGGATGCACATCACAGGAGGGAG

GAACAACTCCAACGTTTCCTATTCAGAAACAAAGAAAAAAGCTCATTCAAGCTGTGAGGGACAACTCGTTCCTCATCGTTACTGGAAATACAGGAAGTGG

TAAAACAACTCAACTCCCTAAATACCTTTATGAAGCAG GGTTTTCACAACATGGTATGATTGGTGTGACTCAGCCACGAAAAGTAGCCGCCATATCAGT

TGCTCAGAGGGTTGCTGAGGAAATGAAATGCACTTTGGGATCTAAAGTAGGATACCAAGTTCGTTTTGATGATTGCAGCTCCAAG - UNI3315 - GA

AACAGCAATCAAATACATGACTGATGGATGTTTACTCAAACATATTTTGGGAGATCCAAATCTTAGCAAATTCAGTGTCATTATTTTGGATGAAGCCCAT

GAAAGAACTTTAACTACA - UNI5060 - GATATCTTATTTGGTTTACTGAAGAAGCTGTTTCAGGATAAGTCTCCTAACAGGAAAGAGCATTTAAAG

GTGGTAGTGATGTCAGCAACTATGGAACTAGCCAAGCTCTCTGCATTCTTTGGAAATTGCCCCATATTTGATATACCTGGAAGACTCTATCCAGTCAGAG

AGAAATTCTGCAATTTGATCGGACCACGAGACAGAGAAAATACTGCATATATTCAAGCG - UNI5060 - ATTGTGAAAGTGACCATGGATATTCATT

TGAATGAAATGGCTGGAGACATCTTAGTTTTTCTGACTG - UNI12698 - - UNI33725 - GCCAGTTTGAGATAGAGAAGAGTTGCGAGCTGCT

CTTTCAGATGGCGGAGTCTGTTGACTATGATTATGATGTACAAGATACCACGCTAGATGGCTTGTTGATTCTGCCATGTTACGGCTCTATGACAACAG -

 UNI33725 - ATCAACAGAGGAGAATATTTTTGCCACCTCCTCCTGGAATTAGAAAATGTGTTATATCCACCAATATTTCTGCAACATCTTTGACAAT

AGATGGGATCAG - UNI33725 - ATATGTGGTGGATGGAGGCTTTGTGAAGCAATTAAATCACAACCCAAGATTAGGGCTGGACATCCTGGAGGTGG

TTCCTATTTCAAA - UNI33714 - AAGTGAAGCATTACAACGCAGTGGCCGTGCGGGCAGGACCGCCTCAGGAAAGTGCTTTAGGATTTACAGTAAA

GAGTTTTGGAGCCAGTGTATGCCTGACCATGTGATCCCAGAGATTAAGAGAACTAGTTTGACATCTGTAGTTCTGACATTAAAGTGCCTTGCCATACATG

ATGTCATAAG - UNI33714 - GTTTCCATATTTGGATCCACCTAATGAGAGACTTATTTTGGAAGCACTTAAACAACTTTATCAGTGTGATGCTATT

GACAG - UNI33714 - GAGTGGCCATGTGACAAGATTGGGATTATCCATGGTGGAGTTCCCTCTCCCCCCACATCTGACGTGTGCAGTGATCAGGGC

TGCTTCTCTTGACTGTGAAGATTTGCTGCTTCCAATAGCAGCAATGCTATCTGTGGAAAATGTCTTCATCAGACCTG - UNI6310 - TTGATCCAGA

GTACCAGAAGGAAGCAGAACAGAGACATCGGGAATTGGCAGCGAAAGCTGGAGGATTTAATGACTTTGCAACTTTAGCTGTCATTTTTGAACAGTGCAAA

TCAAG - UNI33546 - TGGAGCTCCGGCTTCGTGGTGCCAGAAGCACTGGATTCACTGGCGGTGCTTATTCTCTGCATTTCGTGTGGAAGCTCAACT

TCGGGAACTGATCAGGAAACTAAAGCAG - UNI33546 - CAAAGTGATTTCCCAAGAGAGACTTTTGAAGGCCCTAAACATGAAGTACTACGAAGAT

GTCTTTGTGCAGGCTACTTCAAAAATGTTGCTCGAAG - UNI33546 - ATCTGTTGGCAGAACATTTTGCACAATGGATGGGCGTGGAAGTCCAGTT

CATATCCATCCTTCCTCAGCA CTTCATGAACAGGAAACCAAACTTGAATGGATAATTTTTCATGAAGTATTAGTTACCACCAAAGTCTATGCAAGAATT

GTGTGCCCAATCCGTTATGAATGGGTGAGAGACTTACTACCCAAGTTGCATGAACTTAATGCGCATGATTTGAGCAGTGTGGCTAGACGTGAAATGAGAG

AAGATGCAAGAAGAAAATGGACAAATAAGGAAAATGTGAAACAGCTAAAGG ATGGAATATCAAAAGAAGTTCTAAAGAAAATGCAAAGAAGAAATGATG

ACAAATCCATATCAGATGCACGGGCTCGCTTCCTTGAGAGAAAGCAACAGAGAATCCAGGACCACAGTGACACATTAAAGGAAACTGGCTAAGCAGTGGA

CTATCCAATTCAGGAAGCAGGAAAGCAGCCAGGAAATGTGCTTCTGTTTTGCCAGTTATTTCCGACAGTACTATCAGAAGGAAGTGGTCAGCAGCTGTTC

CTAGCCTGTGAGCCGAAAGCAAATCAGAATTTATAAATCACATCTCATCAATACTAACAAATGACATTTTGAAAGGAAAGATTGGGTTGCATAGTCATAG

TACATGAATCCAATCAAAGATGATACAATATTTCCCTCACTTCTGTTTTGCTGGCCTTAACTGGTATCAAACAGTGTCACTGAGATATTTTCAAAGAACA

CTGAATTGTATTTAATCAGCGTGTATTCCATTTGCATTGAAGCATTAAAGATTATTTTCC
Translation
MSRFPAVAGRAPRRQEEGERPIELQEERPSAVRIADRE EEKGCTSQEGGTTPTFPIQKQRKKLIQAVRDNSFLIVTGNTGSGKTTQLPKYLYEAG GFS

QHGMIGVTQPRKVAAISVAQRVAEEMKCTLGSKVGYQVRFDDCSSK - UNI3315 - ETAIKYMTDGCLLKHILGDPNLSKFSVIILDEAHERTLTT 

- UNI5060 - DILFGLLKKLFQDKSPNRKEHLKVVVMSATMELAKLSAFFGNCPIFDIPGRLYPVREKFCNLIGPRDRENTAYIQA - UNI5060 -

 IVKVTMDIHLNEMAGDILVFLTG - UNI12698 - - UNI33725 - GQFEIEKSCELLFQMAESVDYDYDVQDTTLDGLLILPCYGSMTTD - U

NI33725 - DQQRRIFLPPPPGIRKCVISTNISATSLTIDGIR - UNI33725 - RYVVDGGFVKQLNHNPRLGLDILEVVPISK - UNI33714 

- KSEALQRSGRAGRTASGKCFRIYSKEFWSQCMPDHVIPEIKRTSLTSVVLTLKCLAIHDVIR - UNI33714 - RFPYLDPPNERLILEALKQLYQ

CDAIDR - UNI33714 - RSGHVTRLGLSMVEFPLPPHLTCAVIRAASLDCEDLLLPIAAMLSVENVFIRPV - UNI6310 - VDPEYQKEAEQRH

RELAAKAGGFNDFATLAVIFEQCKSS - UNI33546 - SGAPASWCQKHWIHWRCLFSAFRVEAQLRELIRKLKQ - UNI33546 - QSDFPRETF

EGPKHEVLRRCLCAGYFKNVARR - UNI33546 - RSVGRTFCTMDGRGSPVHIHPSSA LHEQETKLEWIIFHEVLVTTKVYARIVCPIRYEWVRDL

LPKLHELNAHDLSSVARREMREDARRKWTNKENVKQLKD DGISKEVLKKMQRRNDDKSISDARARFLERKQQRIQDHSDTLKETG
Transcript ENSMUST00000081401
Sequence
TCCCCTCCCATCTCCTCGGCTCCGTGGACGTGTTCGCTTCTTCTCCGGACCGGGTCTATGTCCCGGTTTCCCGCCGTCGCGGGCAGGGCGCCAAGGCGGC

AGGAGGAAGGCGAGCGGCCAATAGAGCTCCAGGAAGAGCGGCCGTCAGCTGTTCGCATCGCTGACAGAG AAGAGAAAGGATGCACATCACAGGAGGGAG

GAACAACTCCAACGTTTCCTATTCAGAAACAAAGAAAAAAGCTCATTCAAGCTGTGAGGGACAACTCGTTCCTCATCGTTACTGGAAATACAGGAAGTGG

TAAAACAACTCAACTCCCTAAATACCTTTATGAAGCAG GGTTTTCACAACATGGTATGATTGGTGTGACTCAGCCACGAAAAGTAGCCGCCATATCAGT

TGCTCAGAGGGTTGCTGAGGAAATGAAATGCACTTTGGGATCTAAAGTAGGATACCAAGTTCGTTTTGATGATTGCAGCTCCAAG - UNI3315 - GA

AACAGCAATCAAATACATGACTGATGGATGTTTACTCAAACATATTTTGGGAGATCCAAATCTTAGCAAATTCAGTGTCATTATTTTGGATGAAGCCCAT

GAAAGAACTTTAACTACA - UNI5060 - GATATCTTATTTGGTTTACTGAAGAAGCTGTTTCAGGATAAGTCTCCTAACAGGAAAGAGCATTTAAAG

GTGGTA - UNI5060 - ATTGTGAAAGTGACCATGGATATTCATTTGAATGAAATGGCTGGAGACATCTTAGTTTTTCTGACTG - UNI12698 - 

- UNI33725 - ATCAACAGAGGAGAATATTTTTGCCACCTCCTCCTGGAATTAGAAAATGTGTTATATCCACCAATATTTCTGCAACATCTTTGACAA

TAGATGGGATCAG - UNI33725 - ATATGTGGTGGATGGAGGCTTTGTGAAGCAATTAAATCACAACCCAAGATTAGGGCTGGACATCCTGGAGGTG

GTTCCTATTTCAAA - UNI33714 - GTTTCCATATTTGGATCCACCTAATGAGAGACTTATTTTGGAAGCACTTAAACAACTTTATCAGTGTGATGC

TATTGACAG - UNI33714 - GAGTGGCCATGTGACAAGATTGGGATTATCCATGGTGGAGTTCCCTCTCCCCCCACATCTGACGTGTGCAGTGATCA

GGGCTGCTTCTCTTGACTGTGAAGATTTGCTGCTTCCAATAGCAGCAATGCTATCTGTGGAAAATGTCTTCATCAGACCTG - UNI6310 - TTGATC

CAGAGTACCAGAAGGAAGCAGAACAGAGACATCGGGAATTGGCAGCGAAAGCTGGAGGATTTAATGACTTTGCAACTTTAGCTGTCATTTTTGAACAGTG

CAAATCAAG - UNI33546 - TGGAGCTCCGGCTTCGTGGTGCCAGAAGCACTGGATTCACTGGCGGTGCTTATTCTCTGCATTTCGTGTGGAAGCTC

AACTTCGGGAACTGATCAGGAAACTAAAGCAG - UNI33546 - CAAAGTGATTTCCCAAGAGAGACTTTTGAAGGCCCTAAACATGAAGTACTACGA

AGATGTCTTTGTGCAGGCTACTTCAAAAATGTTGCTCGAAG - UNI33546 - ATCTGTTGGCAGAACATTTTGCACAATGGATGGGCGTGGAAGTCC

AGTTCATATCCATCCTTCCTCAGCA CTTCATGAACAGGAAACCAAACTTGAATGGATAATTTTTCATGAAGTATTAGTTACCACCAAAGTCTATGCAAG

AATTGTGTGCCCAATCCGTTATGAATGGGTGAGAGACTTACTACCCAAGTTGCATGAACTTAATGCGCATGATTTGAGCAGTGTGGCTAGACGTGAAATG

AGAGAAGATGCAAGAAGAAAATGGACAAATAAGGAAAATGTGAAACAGCTAAAGG ATGGAATATCAAAAGAAGTTCTAAAGAAAATGCAAAGAAGAAAT

GATGACAAATCCATATCAGATGCACGGGCTCGCTTCCTTGAGAGAAAGCAACAGAGAATCCAGGACCACAGTGACACATTAAAGGAAACTGGCTAAGCAG

TGGACTATCCAATTCAGGAAGCAGGAAAGCAGCCAGGAAATGTGCTTCTGTTTTGCCAGTTATTTCCGACAGTACTATCAGAAGGAAGTGGTCAGCAGCT

GTTCCTAGCCTGTGAGCCGAAAGCAAATCAGAATTTATAAATCACATCTCATCAATACTAACAAATGACATTTTGAAAGGAAAGATTGGGTTGCATAGTC

ATAGTACATGAATCCAATCAAAGATGATACAATATTTCCCTCACTTCTGTTTTGCTGGCCTTAACTGGTATCAAACAGTGTCACTGAGATATTTTCAAAG

AACACTGAATTGTATTTAATCAGCGTGTATTCCATTTGCATTGAAGCATTAAAGATTATTTTCC
Translation
  MKCTLGSKVGYQVRFDDCSSK - UNI3315 - ETAIKYMTDGCLLKHILGDPNLSKFSVIILDEAHERTLTT - UNI5060 - DILFGLLKKLF

QDKSPNRKEHLKVV - UNI5060 - IVKVTMDIHLNEMAGDILVFLTD - UNI12698 - - UNI33725 - DQQRRIFLPPPPGIRKCVISTNI

SATSLTIDGIR - UNI33725 - RYVVDGGFVKQLNHNPRLGLDILEVVPISK - UNI33714 - KFPYLDPPNERLILEALKQLYQCDAIDR - 

UNI33714 - RSGHVTRLGLSMVEFPLPPHLTCAVIRAASLDCEDLLLPIAAMLSVENVFIRPV - UNI6310 - VDPEYQKEAEQRHRELAAKAGG

FNDFATLAVIFEQCKSS - UNI33546 - SGAPASWCQKHWIHWRCLFSAFRVEAQLRELIRKLKQ - UNI33546 -  - UNI33546 -   

For any suggestions or comments, please send an email to unitrap@crg.es