Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000018428 (Akap1)
Chromosomal location
Chr 11: 88692106 - 88725900 (-)
Description
A kinase (PRKA) anchor protein 1 Gene [Source:MGI (curated);Acc:Akap1-002]
RefSeq_dna
NM_009648 NM_001042541 
RefSeq_peptide
NP_033778.2 NP_001036006.1 
UniGene
Mm.465395 Mm.2969 
MGI
MGI:104729 
Uniprot/SWISSPROT
O08715 
Uniprot/SPTREMBL
B1AR25 B2KGS8 Q9CTT7 
Human Ortholog
ENSG00000121057 (AKAP1)
Omim not available
UniTrap UNI10502
Vector Insertion
Chr 11: 88725032 - 88725710
Public Clones P065E10 (ggtc) P143G10 (ggtc) E125E02 (ggtc) P065F09 (ggtc) IST13248H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38272
Vector Insertion
Chr 11: 88712664 - 88725032
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9298
Vector Insertion
Chr 11: 88705572 - 88707180
Public Clones XJ080 (baygenomics) RRD046 (baygenomics) XH123 (baygenomics) RRB025 (baygenomics)
M077C02 (ggtc) W059B05 (ggtc) A039D06 (ggtc) A039C04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29476
Vector Insertion
Chr 11: 88705572 - 88712818
Public Clones P135C12 (ggtc) D048E06 (ggtc) P143G10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37094
Vector Insertion
Chr 11: 88701066 - 88702482
Public Clones CMHD-GT_519H10-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2116
Vector Insertion
Chr 11: 88698504 - 88700243
Public Clones AK0011 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2197
Vector Insertion
Chr 11: 88694530 - 88695975
Public Clones XR0900 (sanger) XR1118 (sanger) XR0901 (sanger) XR0904 (sanger)
AD0284 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107904
Sequence
ATGGGATGCAAGACAGGTCCCAAACCTTTTGGCGGTGGAGAGACCATAAGACCAATTAGGATCCGGAG - UNI9298 - - UNI29476 - GTGTAG

CTACTTCACATCGACTGACTCCAAGATGGCAATCCAGTTGCGTTCGCTCTTCCCCTTGGCGTTGCCCGGAATGCTGGCCCTCCTTGGCTGGTGGTGGTTT

TTCTCTCGTAAAAAAGATCGGCTCAGCAGCAGTGATAAGCAGGTGGAGACACTGAAGGTTGGCCCTGCCATCAAGGACCGACGGCTCAGTGAAGAGGCCT

GTCCTGGAGTCCTGTCTGTGGCCCCCACTGTCACACAGCCTCCTGGAAGGGAAGAGCAGCGCTGTGTGGACAAGCCTTCTACAGAGCCCCTGGCCTTGCC

GAGGACTCGCCAGGTTCGACGAAGATCAGAGTCCTCAGGCAACCTCCCCAGCGTTGCAGACACGAGGTCGCAGCCAGGACCGTGCAGAGATGAGATCGCC

AAAGTGGAACTCTCCCTGATGGGGGACAAAGCCAAATCTATTCCTCTTGGATGTCCGCTTCTCCCAAAGGATGCGTCCTTCCCCTATGAAGCAGTGGAAA

GGTGTAAGCAGGAGTCCGCACTGGGCAAGACTCCTGGAAGAGGCTGGCCAAGCCCGTATGCGGCCTCTGGAGAGAAAGCGAGAGAGACAGGTGGGACAGA

GGGGACTGGAGATGCTGTGTTGGGGGAAAATGTATCTGAGGAAGGCCTATTGTCCCAGGAGTGTGTCTCAGAAGTGGAGAAGAGTGAGTTTCCAATCCTG

GCCCCCGGGGGAGGTGAGGGAGAAGAGGTGAGCCATGGCCCCCCACAGGTAGCTGAACTTTTAAAGAAGGAAGAATATATTGTTGGGAAGTTGCCGAGTA

GCTTTGTGGAGCCAGTTCACTCAGAGCCGGTTAAGGACGAGGATGCGTTGGAACCCCAGGTCAAAGGTAGCAGCAATACTTCGGATAGAGACCTGGCTGG

AGAGCTGGACAAAGACGAGACCGTGCCTGAAAATGACCAGATTAAGCAGGCTGCCTTCCAGCTCATCTCCCAGGTGATCTTGGAAGCAACTGAAGAGTTT

CGGGCCACCACAGTGGGCAAGACTGTGGCACAAGTGCACCCAACCTCGGCCACTCAGCCTAAGGGGAAGGAGGAGAGCTGTGTTCCAGCCAGCCAGGAAA

CTAGCTTGGGACAAGACACCTCAGATCCTGCTTCCACCAGAACAGGTGCCACTGCCAGCCCTTCAGCAGAAGCTCTGCCACCAAAGACCTATGTAAGCTG

TCTCAGCAGCCCTCTGTCAGGCCCCACCAAGGACCAGAAGCCAAAGAACTCTGCACATCACATCTCCCTGGCTCCCTGCCCACCGCCAGTCACCCCCCAG

AGGCAGTCTCTGGAGGGGGCAAGTAACCCGAGAGGTGATGACAACTTTGTCGCCTGTATGGCCAACAACAGCCAGAGTGTCCTTTCAGTTAGCTCCTTGG

GGCAGTGCTCAGATCCTGTCAGTACTTCGGGGCTTGAAGACTCTTGCACAGAGACCATCTCAAGCTCCGGAGACAAAGCTATGACCCCACCACTGCCAGT

CAGTACTCAGCCCTTCAGCAACGGGGTGCTGAAGGAGGAGCTGTCAGACTTAGGGACCGAGGATGGATGGACCATGGATACAGAAGCAGATCACTCAGGA

G - UNI9298 - - UNI29476 - GTTCTGACGGGAACAGTATGGATTCAGTGGATAGCTGTTGCGGGCTTACCAAGCCCGATAGCCCCCAGAGTGT

CCAGGCAGGCTCCAACCCTAAGAAGGTTGACCTTATCATCTGGGAGATCGAGGTGCCAAAG CACTTAGTTGGTCGACTGATTGGCAAGCAGGGACGGTA

CGTGAGTTTTCTGAAGCAGACATCTGGTGCCAAGATCTACATCTCCACCCTGCCTTACACACAGAACATCCAGATCTGCCACATAGAAG GCTCTCAGCA

CCATGTAGACAAAGCTCTGAACTTGATTGGGAAGAAGTTTAAGGAACTGAACCTCACCAATATCTATGCGCCACCACTGCCTTCGCTGGCACTGCCTTCC

TTGCCGATGACGTCTTGG - UNI2116 - CTCATGCTGCCTGATGGTATCACTGTGGAAGTCATCGTGGTCAACCAGGTCAATGCTGGGCACCTATTT

GTCCAGCAGCACACACACCCCACCTTCCATGCACTGCGCAGTCTGGACCAGCAGATGTACCTCTGTTACTCTCAGCCTGGAATCCCCACCTTGCCCACCC

CAGTGGAAA TCACGGTTATCTGCGCTGCCCCTGGTGCGGACGGGGCCTGGTGGCGAGCCCAAGTAGTGGCTTCCTATGAGGAGACCAATGAGGTGGAGA

TTCGCTACGTGGACTATGGTGGATATAAGAGAGTGAAAGTCGACGTGCTCCGGCAAATTAG GTCTGACTTTGTGACCCTGCCATTCCAAGGAGCAGAAG

TCCTTCTGGACAGTGTGGTTCCTCTGTCAG - UNI2197 - ATGATGATCATTTTTCACCGGAGGCAGACGCAGCCATGAGTGAGATGACAGGCAATA

CAGCACTGTTGGCCCAG GTGACAAGCTACAGTGCGACTGGCCTTCCTCTGATTCAGCTATGGAGTGTGGTTGGAGATGAA GTGGTGTTGATAAACCGG

TCGCTGGTGGAGCGAGGCCTTGCACAGTGGGTAGACAGCTACTATGCCAGCCTCTGACCTTGGCTCCTGAGTTGCTTCGGTCTTCTTTGCACTGTTGAGA

GTGGGTTTGGCACCCAGGACAGAGTTTTAAGAGCAGAGTAACAAACACTGTTCTCACTGAGTCTTCTTTCCCCATTCTGTAGTCCTGTGGAGGAGGAGGG

TCCTCCCAGGAGGACCTGTGTGTTCTTTCAAAGCCTTAGAGTGGCGCTACACCGGCCAGCTGGCTTAGCTGCAGGAAGGCCTCTTAGCCAGGCTATTCCC

ATTCCATCCGCTCCCTTCTCCCCACCCAAACCCCACACTGCAGCAGGCAGGCCAGGGCGGGTGTGGGGCTGGCTGAGAGGATCAATTTTAGAGTCTTTAT

TCAGGGAGTGAGACATGGACTAATTGGTATCGATTCCCTGGATAGCTCGCTTGGATGAATTGATGGTGTTTAGCAGTTTTTATATACTTCCTCCGGGTCT

CTAGGAACTCAGACTTTTTTAAACATAGATGTAAATAAGGAACAGTTTGTCACACCTGACCCCAGTGAGTGGGGGGAAGGGCAGCTGTTATCTTGCCAAG

CCTGGTTGTAATTTGTAACCATTTTCTATTTGTTCGAACTCTGTAAATAATATGTTTAAAGATGTAATATTTTGTACAAGACACACTGGAGAACAAAGGG

AACTCAAAACTCTTCCACATTCTTCCCGAGGAAATCGACGACGTCCATCCGTCCCACAGAGTGGGACCGACCGCCCCTGCTGCTCCAGCCAGGGCCCCTG

CGCTTCCTGTGCAGACAGGAAGCTGTGTGGGAGACTGTCATTTGGGAATTTGATTTTTTTTTTTCTGTACGAATTTAAAAAAAAAAGAAAAAAAAGAAAC

TTCATTGAATTACCTTGCAGTGGTGTTGACTCTTTTATAGACTGTCTTTAGCATTGTGCAATTTAAGAATAACTTAAGGATCTTGGACTTTACATAAATC

TTGAATTGTATAAACTCTAA
Translation
MGCKTGPKPFGGGETIRPIRIRR - UNI9298 - - UNI29476 - RCSYFTSTDSKMAIQLRSLFPLALPGMLALLGWWWFFSRKKDRLSSSDKQV

ETLKVGPAIKDRRLSEEACPGVLSVAPTVTQPPGREEQRCVDKPSTEPLALPRTRQVRRRSESSGNLPSVADTRSQPGPCRDEIAKVELSLMGDKAKSIP

LGCPLLPKDASFPYEAVERCKQESALGKTPGRGWPSPYAASGEKARETGGTEGTGDAVLGENVSEEGLLSQECVSEVEKSEFPILAPGGGEGEEVSHGPP

QVAELLKKEEYIVGKLPSSFVEPVHSEPVKDEDALEPQVKGSSNTSDRDLAGELDKDETVPENDQIKQAAFQLISQVILEATEEFRATTVGKTVAQVHPT

SATQPKGKEESCVPASQETSLGQDTSDPASTRTGATASPSAEALPPKTYVSCLSSPLSGPTKDQKPKNSAHHISLAPCPPPVTPQRQSLEGASNPRGDDN

FVACMANNSQSVLSVSSLGQCSDPVSTSGLEDSCTETISSSGDKAMTPPLPVSTQPFSNGVLKEELSDLGTEDGWTMDTEADHSGG - UNI9298 - -

 UNI29476 - GSDGNSMDSVDSCCGLTKPDSPQSVQAGSNPKKVDLIIWEIEVPK HLVGRLIGKQGRYVSFLKQTSGAKIYISTLPYTQNIQICHIE

G GSQHHVDKALNLIGKKFKELNLTNIYAPPLPSLALPSLPMTSW - UNI2116 - LMLPDGITVEVIVVNQVNAGHLFVQQHTHPTFHALRSLDQQM

YLCYSQPGIPTLPTPVEI ITVICAAPGADGAWWRAQVVASYEETNEVEIRYVDYGGYKRVKVDVLRQIR RSDFVTLPFQGAEVLLDSVVPLSD - UN

I2197 - DDDHFSPEADAAMSEMTGNTALLAQ VTSYSATGLPLIQLWSVVGDE VVLINRSLVERGLAQWVDSYYASL
Transcript ENSMUST00000107903
Sequence
AGACCCCCAGGGATGAAGGGAACACCCGGGCTAGGCTAAGACCAGCGGGCCTGAGGCATGGCTCCATCTCTGTGACCCTGGGCCTCAGCCATGCTGCCGC

GGGAGAGTGGCCCAGGCTCACCATCACCCCCAGAACTGCACTCTGCCAGCAAG - UNI9298 - - UNI29476 - GTGTAGCTACTTCACATCGAC

TGACTCCAAGATGGCAATCCAGTTGCGTTCGCTCTTCCCCTTGGCGTTGCCCGGAATGCTGGCCCTCCTTGGCTGGTGGTGGTTTTTCTCTCGTAAAAAA

GATCGGCTCAGCAGCAGTGATAAGCAGGTGGAGACACTGAAGGTTGGCCCTGCCATCAAGGACCGACGGCTCAGTGAAGAGGCCTGTCCTGGAGTCCTGT

CTGTGGCCCCCACTGTCACACAGCCTCCTGGAAGGGAAGAGCAGCGCTGTGTGGACAAGCCTTCTACAGAGCCCCTGGCCTTGCCGAGGACTCGCCAGGT

TCGACGAAGATCAGAGTCCTCAGGCAACCTCCCCAGCGTTGCAGACACGAGGTCGCAGCCAGGACCGTGCAGAGATGAGATCGCCAAAGTGGAACTCTCC

CTGATGGGGGACAAAGCCAAATCTATTCCTCTTGGATGTCCGCTTCTCCCAAAGGATGCGTCCTTCCCCTATGAAGCAGTGGAAAGGTGTAAGCAGGAGT

CCGCACTGGGCAAGACTCCTGGAAGAGGCTGGCCAAGCCCGTATGCGGCCTCTGGAGAGAAAGCGAGAGAGACAGGTGGGACAGAGGGGACTGGAGATGC

TGTGTTGGGGGAAAATGTATCTGAGGAAGGCCTATTGTCCCAGGAGTGTGTCTCAGAAGTGGAGAAGAGTGAGTTTCCAATCCTGGCCCCCGGGGGAGGT

GAGGGAGAAGAGGTGAGCCATGGCCCCCCACAGGTAGCTGAACTTTTAAAGAAGGAAGAATATATTGTTGGGAAGTTGCCGAGTAGCTTTGTGGAGCCAG

TTCACTCAGAGCCGGTTAAGGACGAGGATGCGTTGGAACCCCAGGTCAAAGGTAGCAGCAATACTTCGGATAGAGACCTGGCTGGAGAGCTGGACAAAGA

CGAGACCGTGCCTGAAAATGACCAGATTAAGCAGGCTGCCTTCCAGCTCATCTCCCAGGTGATCTTGGAAGCAACTGAAGAGTTTCGGGCCACCACAGTG

GGCAAGACTGTGGCACAAGTGCACCCAACCTCGGCCACTCAGCCTAAGGGGAAGGAGGAGAGCTGTGTTCCAGCCAGCCAGGAAACTAGCTTGGGACAAG

ACACCTCAGATCCTGCTTCCACCAGAACAGGTGCCACTGCCAGCCCTTCAGCAGAAGCTCTGCCACCAAAGACCTATGTAAGCTGTCTCAGCAGCCCTCT

GTCAGGCCCCACCAAGGACCAGAAGCCAAAGAACTCTGCACATCACATCTCCCTGGCTCCCTGCCCACCGCCAGTCACCCCCCAGAGGCAGTCTCTGGAG

GGGGCAAGTAACCCGAGAGGTGATGACAACTTTGTCGCCTGTATGGCCAACAACAGCCAGAGTGTCCTTTCAGTTAGCTCCTTGGGGCAGTGCTCAGATC

CTGTCAGTACTTCGGGGCTTGAAGACTCTTGCACAGAGACCATCTCAAGCTCCGGAGACAAAGCTATGACCCCACCACTGCCAGTCAGTACTCAGCCCTT

CAGCAACGGGGTGCTGAAGGAGGAGCTGTCAGACTTAGGGACCGAGGATGGATGGACCATGGATACAGAAGCAGATCACTCAGGAG - UNI9298 - -

 UNI29476 - GTTCTGACGGGAACAGTATGGATTCAGTGGATAGCTGTTGCGGGCTTACCAAGCCCGATAGCCCCCAGAGTGTCCAGGCAGGCTCCAA

CCCTAAGAAGGTTGACCTTATCATCTGGGAGATCGAGGTGCCAAAG CACTTAGTTGGTCGACTGATTGGCAAGCAGGGACGGTACGTGAGTTTTCTGAA

GCAGACATCTGGTGCCAAGATCTACATCTCCACCCTGCCTTACACACAGAACATCCAGATCTGCCACATAGAAG GCTCTCAGCACCATGTAGACAAAGC

TCTGAACTTGATTGGGAAGAAGTTTAAGGAACTGAACCTCACCAATATCTATGCGCCACCACTGCCTTCGCTGGCACTGCCTTCCTTGCCGATGACGTCT

TGG - UNI2116 - CTCATGCTGCCTGATGGTATCACTGTGGAAGTCATCGTGGTCAACCAGGTCAATGCTGGGCACCTATTTGTCCAGCAGCACACA

CACCCCACCTTCCATGCACTGCGCAGTCTGGACCAGCAGATGTACCTCTGTTACTCTCAGCCTGGAATCCCCACCTTGCCCACCCCAGTGGAAA TCACG

GTTATCTGCGCTGCCCCTGGTGCGGACGGGGCCTGGTGGCGAGCCCAAGTAGTGGCTTCCTATGAGGAGACCAATGAGGTGGAGATTCGCTACGTGGACT

ATGGTGGATATAAGAGAGTGAAAGTCGACGTGCTCCGGCAAATTAG GTCTGACTTTGTGACCCTGCCATTCCAAGGAGCAGAAGTCCTTCTGGACAGTG

TGGTTCCTCTGTCAG - UNI2197 - ATGATGATCATTTTTCACCGGAGGCAGACGCAGCCATGAGTGAGATGACAGGCAATACAGCACTGTTGGCCC

AG GTGACAAGCTACAGTGCGACTGGCCTTCCTCTGATTCAGCTATGGAGTGTGGTTGGAGATGAA GTGGTGTTGATAAACCGGTCGCTGGTGGAGCGA

GGCCTTGCACAGTGGGTAGACAGCTACTATGCCAGCCTCTGACCTTGGCTCCTGAGTTGCTTCGGTCTTCTTTGCACTGTTGAGAGTGGGTTTGGCACCC

AGGACAGAGTTTTAAGAGCAGAGTAACAAACACTGTTCTCACTGAGTCTTCTTTCCCCATTCTGTAGTCCTGTGGAGGAGGAGGGTCCTCCCAGGAGGAC

CTGTGTGTTCTTTCAAAGCCTTAGAGTGGCGCTACACCGGCCAGCTGGCTTAGCTGCAGGAAGGCCTCTTAGCCAGGCTATTCCCATTCCATCCGCTCCC

TTCTCCCCACCCAAACCCCACACTGCAGCAGGCAGGCCAGGGCGGGTGTGGGGCTGGCTGAGAGGATCAATTTTAGAGTCTTTATTCAGGGAGTGAGACA

TGGACTAATTGGTATCGATTCCCTGGATAGCTCGCTTGGATGAATTGATGGTGTTTAGCAGTTTTTATATACTTCCTCCGGGTCTCTAGGAACTCAGACT

TTTTTAAACATAGATGTAAATAAGGAACAGTTTGTCACACCTGACCCCAGTGAGTGGGGGGAAGGGCAGCTGTTATCTTGCCAAGCCTGGTTGTAATTTG

TAACCATTTTCTATTTGTTCGAACTCTGTAAATAATATGTTTAAAGATGTAATATTTTGTACAAGACACACTGGAGAACAAAGGGAACTCAAAACTCTTC

CACATTCTTCCCGAGGAAATCGACGACGTCCATCCGTCCCACAGAGTGGGACCGACCGCCCCTGCTGCTCCAGCCAGGGCCCCTGCGCTTCCTGTGCAGA

CAGGAAGCTGTGTGGGAGACTGTCATTTGGGAATTTGATTTTTTTTTTTCTGTACGAATTTAAAAAAAAAAGAAAAAAAAGAAACTTCATTGAATTACCT

TGCAGTGGTGTTGACTCTTTTATAGACTGTCTTTAGCATTGTGCAATTTAAGAATAACTTAAGGATCTTGGACTTTACATAAATCTTGAATTGTATAAAC

TCTAA
Translation
 - UNI9298 - - UNI29476 - MAIQLRSLFPLALPGMLALLGWWWFFSRKKDRLSSSDKQVETLKVGPAIKDRRLSEEACPGVLSVAPTVTQPPG

REEQRCVDKPSTEPLALPRTRQVRRRSESSGNLPSVADTRSQPGPCRDEIAKVELSLMGDKAKSIPLGCPLLPKDASFPYEAVERCKQESALGKTPGRGW

PSPYAASGEKARETGGTEGTGDAVLGENVSEEGLLSQECVSEVEKSEFPILAPGGGEGEEVSHGPPQVAELLKKEEYIVGKLPSSFVEPVHSEPVKDEDA

LEPQVKGSSNTSDRDLAGELDKDETVPENDQIKQAAFQLISQVILEATEEFRATTVGKTVAQVHPTSATQPKGKEESCVPASQETSLGQDTSDPASTRTG

ATASPSAEALPPKTYVSCLSSPLSGPTKDQKPKNSAHHISLAPCPPPVTPQRQSLEGASNPRGDDNFVACMANNSQSVLSVSSLGQCSDPVSTSGLEDSC

TETISSSGDKAMTPPLPVSTQPFSNGVLKEELSDLGTEDGWTMDTEADHSGG - UNI9298 - - UNI29476 - GSDGNSMDSVDSCCGLTKPDSP

QSVQAGSNPKKVDLIIWEIEVPK HLVGRLIGKQGRYVSFLKQTSGAKIYISTLPYTQNIQICHIEG GSQHHVDKALNLIGKKFKELNLTNIYAPPLPS

LALPSLPMTSW - UNI2116 - LMLPDGITVEVIVVNQVNAGHLFVQQHTHPTFHALRSLDQQMYLCYSQPGIPTLPTPVEI ITVICAAPGADGAWW

RAQVVASYEETNEVEIRYVDYGGYKRVKVDVLRQIR RSDFVTLPFQGAEVLLDSVVPLSD - UNI2197 - DDDHFSPEADAAMSEMTGNTALLAQ 

VTSYSATGLPLIQLWSVVGDE VVLINRSLVERGLAQWVDSYYASL
Transcript ENSMUST00000018572
Sequence
GCGTCGCGCCGCGGGCACGTCGTTGCGCGTCCTCAGTATTTAATGTCTCTGTGTTCGCCCGGCCTGGGCTAGCACGTGGGGGAGCGGCCGAAGCGCCGTG

CAGCGCTGCGGGGCAGGGCCGCTGGACTAGGTGGGGGGCCAGGGGGCGGTGGCGGGAGGATTGAGTGCCTAGACGGTCGCCCAGGAGCAG - UNI9298

 - - UNI10502 - - UNI29476 - GTGTAGCTACTTCACATCGACTGACTCCAAGATGGCAATCCAGTTGCGTTCGCTCTTCCCCTTGGCGTTGC

CCGGAATGCTGGCCCTCCTTGGCTGGTGGTGGTTTTTCTCTCGTAAAAAAGATCGGCTCAGCAGCAGTGATAAGCAGGTGGAGACACTGAAGGTTGGCCC

TGCCATCAAGGACCGACGGCTCAGTGAAGAGGCCTGTCCTGGAGTCCTGTCTGTGGCCCCCACTGTCACACAGCCTCCTGGAAGGGAAGAGCAGCGCTGT

GTGGACAAGCCTTCTACAGAGCCCCTGGCCTTGCCGAGGACTCGCCAGGTTCGACGAAGATCAGAGTCCTCAGGCAACCTCCCCAGCGTTGCAGACACGA

GGTCGCAGCCAGGACCGTGCAGAGATGAGATCGCCAAAGTGGAACTCTCCCTGATGGGGGACAAAGCCAAATCTATTCCTCTTGGATGTCCGCTTCTCCC

AAAGGATGCGTCCTTCCCCTATGAAGCAGTGGAAAGGTGTAAGCAGGAGTCCGCACTGGGCAAGACTCCTGGAAGAGGCTGGCCAAGCCCGTATGCGGCC

TCTGGAGAGAAAGCGAGAGAGACAGGTGGGACAGAGGGGACTGGAGATGCTGTGTTGGGGGAAAATGTATCTGAGGAAGGCCTATTGTCCCAGGAGTGTG

TCTCAGAAGTGGAGAAGAGTGAGTTTCCAATCCTGGCCCCCGGGGGAGGTGAGGGAGAAGAGGTGAGCCATGGCCCCCCACAGGTAGCTGAACTTTTAAA

GAAGGAAGAATATATTGTTGGGAAGTTGCCGAGTAGCTTTGTGGAGCCAGTTCACTCAGAGCCGGTTAAGGACGAGGATGCGTTGGAACCCCAGGTCAAA

GGTAGCAGCAATACTTCGGATAGAGACCTGGCTGGAGAGCTGGACAAAGACGAGACCGTGCCTGAAAATGACCAGATTAAGCAGGCTGCCTTCCAGCTCA

TCTCCCAGGTGATCTTGGAAGCAACTGAAGAGTTTCGGGCCACCACAGTGGGCAAGACTGTGGCACAAGTGCACCCAACCTCGGCCACTCAGCCTAAGGG

GAAGGAGGAGAGCTGTGTTCCAGCCAGCCAGGAAACTAGCTTGGGACAAGACACCTCAGATCCTGCTTCCACCAGAACAGGTGCCACTGCCAGCCCTTCA

GCAGAAGCTCTGCCACCAAAGACCTATGTAAGCTGTCTCAGCAGCCCTCTGTCAGGCCCCACCAAGGACCAGAAGCCAAAGAACTCTGCACATCACATCT

CCCTGGCTCCCTGCCCACCGCCAGTCACCCCCCAGAGGCAGTCTCTGGAGGGGGCAAGTAACCCGAGAGGTGATGACAACTTTGTCGCCTGTATGGCCAA

CAACAGCCAGAGTGTCCTTTCAGTTAGCTCCTTGGGGCAGTGCTCAGATCCTGTCAGTACTTCGGGGCTTGAAGACTCTTGCACAGAGACCATCTCAAGC

TCCGGAGACAAAGCTATGACCCCACCACTGCCAGTCAGTACTCAGCCCTTCAGCAACGGGGTGCTGAAGGAGGAGCTGTCAGACTTAGGGACCGAGGATG

GATGGACCATGGATACAGAAGCAGATCACTCAGGAG - UNI9298 - - UNI29476 - GTTCTGACGGGAACAGTATGGATTCAGTGGATAGCTGT

TGCGGGCTTACCAAGCCCGATAGCCCCCAGAGTGTCCAGGCAGGCTCCAACCCTAAGAAGGTTGACCTTATCATCTGGGAGATCGAGGTGCCAAAG CAC

TTAGTTGGTCGACTGATTGGCAAGCAGGGACGGTACGTGAGTTTTCTGAAGCAGACATCTGGTGCCAAGATCTACATCTCCACCCTGCCTTACACACAGA

ACATCCAGATCTGCCACATAGAAG GCTCTCAGCACCATGTAGACAAAGCTCTGAACTTGATTGGGAAGAAGTTTAAGGAACTGAACCTCACCAATATCT

ATGCGCCACCACTGCCTTCGCTGGCACTGCCTTCCTTGCCGATGACGTCTTGG - UNI2116 - CTCATGCTGCCTGATGGTATCACTGTGGAAGTCA

TCGTGGTCAACCAGGTCAATGCTGGGCACCTATTTGTCCAGCAGCACACACACCCCACCTTCCATGCACTGCGCAGTCTGGACCAGCAGATGTACCTCTG

TTACTCTCAGCCTGGAATCCCCACCTTGCCCACCCCAGTGGAAA TCACGGTTATCTGCGCTGCCCCTGGTGCGGACGGGGCCTGGTGGCGAGCCCAAGT

AGTGGCTTCCTATGAGGAGACCAATGAGGTGGAGATTCGCTACGTGGACTATGGTGGATATAAGAGAGTGAAAGTCGACGTGCTCCGGCAAATTAG GTC

TGACTTTGTGACCCTGCCATTCCAAGGAGCAGAAGTCCTTCTGGACAGTGTGGTTCCTCTGTCAG - UNI2197 - ATGATGATCATTTTTCACCGGA

GGCAGACGCAGCCATGAGTGAGATGACAGGCAATACAGCACTGTTGGCCCAG GTGACAAGCTACAGTGCGACTGGCCTTCCTCTGATTCAGCTATGGAG

TGTGGTTGGAGATGAA GTGGTGTTGATAAACCGGTCGCTGGTGGAGCGAGGCCTTGCACAGTGGGTAGACAGCTACTATGCCAGCCTCTGACCTTGGCT

CCTGAGTTGCTTCGGTCTTCTTTGCACTGTTGAGAGTGGGTTTGGCACCCAGGACAGAGTTTTAAGAGCAGAGTAACAAACACTGTTCTCACTGAGTCTT

CTTTCCCCATTCTGTAGTCCTGTGGAGGAGGAGGGTCCTCCCAGGAGGACCTGTGTGTTCTTTCAAAGCCTTAGAGTGGCGCTACACCGGCCAGCTGGCT

TAGCTGCAGGAAGGCCTCTTAGCCAGGCTATTCCCATTCCATCCGCTCCCTTCTCCCCACCCAAACCCCACACTGCAGCAGGCAGGCCAGGGCGGGTGTG

GGGCTGGCTGAGAGGATCAATTTTAGAGTCTTTATTCAGGGAGTGAGACATGGACTAATTGGTATCGATTCCCTGGATAGCTCGCTTGGATGAATTGATG

GTGTTTAGCAGTTTTTATATACTTCCTCCGGGTCTCTAGGAACTCAGACTTTTTTAAACATAGATGTAAATAAGGAACAGTTTGTCACACCTGACCCCAG

TGAGTGGGGGGAAGGGCAGCTGTTATCTTGCCAAGCCTGGTTGTAATTTGTAACCATTTTCTATTTGTTCGAACTCTGTAAATAATATGTTTAAAGATGT

AATATTTTGTACAAGACACACTGGAGAACAAAGGGAACTCAAAACTCTTCCACATTCTTCCCGAGGAAATCGACGACGTCCATCCGTCCCACAGAGTGGG

ACCGACCGCCCCTGCTGCTCCAGCCAGGGCCCCTGCGCTTCCTGTGCAGACAGGAAGCTGTGTGGGAGACTGTCATTTGGGAATTTGATTTTTTTTTTTC

TGTACGAATTTAAAAAAAAAAGAAAAAAAAGAAACTTCATTGAATTACCTTGCAGTGGTGTTGACTCTTTTATAGACTGTCTTTAGCATTGTGCAATTTA

AGAATAACTTAAGGATCTTGGACTTTACATAAATCTTGAATTGTATAAACTCTAA
Translation
 - UNI9298 - - UNI10502 - - UNI29476 - MAIQLRSLFPLALPGMLALLGWWWFFSRKKDRLSSSDKQVETLKVGPAIKDRRLSEEACPG

VLSVAPTVTQPPGREEQRCVDKPSTEPLALPRTRQVRRRSESSGNLPSVADTRSQPGPCRDEIAKVELSLMGDKAKSIPLGCPLLPKDASFPYEAVERCK

QESALGKTPGRGWPSPYAASGEKARETGGTEGTGDAVLGENVSEEGLLSQECVSEVEKSEFPILAPGGGEGEEVSHGPPQVAELLKKEEYIVGKLPSSFV

EPVHSEPVKDEDALEPQVKGSSNTSDRDLAGELDKDETVPENDQIKQAAFQLISQVILEATEEFRATTVGKTVAQVHPTSATQPKGKEESCVPASQETSL

GQDTSDPASTRTGATASPSAEALPPKTYVSCLSSPLSGPTKDQKPKNSAHHISLAPCPPPVTPQRQSLEGASNPRGDDNFVACMANNSQSVLSVSSLGQC

SDPVSTSGLEDSCTETISSSGDKAMTPPLPVSTQPFSNGVLKEELSDLGTEDGWTMDTEADHSGG - UNI9298 - - UNI29476 - GSDGNSMDS

VDSCCGLTKPDSPQSVQAGSNPKKVDLIIWEIEVPK HLVGRLIGKQGRYVSFLKQTSGAKIYISTLPYTQNIQICHIEG GSQHHVDKALNLIGKKFKE

LNLTNIYAPPLPSLALPSLPMTSW - UNI2116 - LMLPDGITVEVIVVNQVNAGHLFVQQHTHPTFHALRSLDQQMYLCYSQPGIPTLPTPVEI IT

VICAAPGADGAWWRAQVVASYEETNEVEIRYVDYGGYKRVKVDVLRQIR RSDFVTLPFQGAEVLLDSVVPLSD - UNI2197 - DDDHFSPEADAAM

SEMTGNTALLAQ VTSYSATGLPLIQLWSVVGDE VVLINRSLVERGLAQWVDSYYASL
Transcript ENSMUST00000107902
Sequence
AGACCCCCAGGGATGAAGGGAACACCCGGGCTAGGCTAAGACCAGCGGGCCTGAGGCATGGCTCCATCTCTGTGACCCTGGGCCTCAGCCATGCTGCCGC

GGGAGAGTGGCCCAGGCTCACCATCACCCCCAGAACTGCACTCTGCCAGCAAG - UNI9298 - - UNI29476 - GTGTAGCTACTTCACATCGAC

TGACTCCAAGATGGCAATCCAGTTGCGTTCGCTCTTCCCCTTGGCGTTGCCCGGAATGCTGGCCCTCCTTGGCTGGTGGTGGTTTTTCTCTCGTAAAAAA

GATCGGCTCAGCAGCAGTGATAAGCAGGTGGAGACACTGAAGGTTGGCCCTGCCATCAAGGACCGACGGCTCAGTGAAGAGGCCTGTCCTGGAGTCCTGT

CTGTGGCCCCCACTGTCACACAGCCTCCTGGAAGGGAAGAGCAGCGCTGTGTGGACAAGCCTTCTACAGAGCCCCTGGCCTTGCCGAGGACTCGCCAGGT

TCGACGAAGATCAGAGTCCTCAGGCAACCTCCCCAGCGTTGCAGACACGAGGTCGCAGCCAGGACCGTGCAGAGATGAGATCGCCAAAGTGGAACTCTCC

CTGATGGGGGACAAAGCCAAATCTATTCCTCTTGGATGTCCGCTTCTCCCAAAGGATGCGTCCTTCCCCTATGAAGCAGTGGAAAGGTGTAAGCAGGAGT

CCGCACTGGGCAAGACTCCTGGAAGAGGCTGGCCAAGCCCGTATGCGGCCTCTGGAGAGAAAGCGAGAGAGACAGGTGGGACAGAGGGGACTGGAGATGC

TGTGTTGGGGGAAAATGTATCTGAGGAAGGCCTATTGTCCCAGGAGTGTGTCTCAGAAGTGGAGAAGAGTGAGTTTCCAATCCTGGCCCCCGGGGGAGGT

GAGGGAGAAGAGGTGAGCCATGGCCCCCCACAGGTAGCTGAACTTTTAAAGAAGGAAGAATATATTGTTGGGAAGTTGCCGAGTAGCTTTGTGGAGCCAG

TTCACTCAGAGCCGGTTAAGGACGAGGATGCGTTGGAACCCCAGGTCAAAGGTAGCAGCAATACTTCGGATAGAGACCTGGCTGGAGAGCTGGACAAAGA

CGAGACCGTGCCTGAAAATGACCAGATTAAGCAGGCTGCCTTCCAGCTCATCTCCCAGGTGATCTTGGAAGCAACTGAAGAGTTTCGGGCCACCACAGTG

GGCAAGACTGTGGCACAAGTGCACCCAACCTCGGCCACTCAGCCTAAGGGGAAGGAGGAGAGCTGTGTTCCAGCCAGCCAGGAAACTAGCTTGGGACAAG

ACACCTCAGATCCTGCTTCCACCAGAACAGGTGCCACTGCCAGCCCTTCAGCAGAAGCTCTGCCACCAAAGACCTATGTAAGCTGTCTCAGCAGCCCTCT

GTCAGGCCCCACCAAGGACCAGAAGCCAAAGAACTCTGCACATCACATCTCCCTGGCTCCCTGCCCACCGCCAGTCACCCCCCAGAGGCAGTCTCTGGAG

GGGGCAAGTAACCCGAGAGGTGATGACAACTTTGTCGCCTGTATGGCCAACAACAGCCAGAGTGTCCTTTCAGTTAGCTCCTTGGGGCAGTGCTCAGATC

CTGTCAGTACTTCGGGGCTTGAAGACTCTTGCACAGAGACCATCTCAAGCTCCGGAGACAAAGCTATGACCCCACCACTGCCAGTCAGTACTCAGCCCTT

CAGCAACGGGGTGCTGAAGGAGGAGCTGTCAGACTTAGGGACCGAGGATGGATGGACCATGGATACAGAAGCAGATCACTCAGGAG - UNI9298 - -

 UNI29476 - TTGCAGCTCCACCCCAGGAAAGAGGGCACTTTGGTAACGGAGGGTGCACTGGGTTTTTCGAGTGCTGA
Translation
 - UNI9298 - - UNI29476 - MAIQLRSLFPLALPGMLALLGWWWFFSRKKDRLSSSDKQVETLKVGPAIKDRRLSEEACPGVLSVAPTVTQPPG

REEQRCVDKPSTEPLALPRTRQVRRRSESSGNLPSVADTRSQPGPCRDEIAKVELSLMGDKAKSIPLGCPLLPKDASFPYEAVERCKQESALGKTPGRGW

PSPYAASGEKARETGGTEGTGDAVLGENVSEEGLLSQECVSEVEKSEFPILAPGGGEGEEVSHGPPQVAELLKKEEYIVGKLPSSFVEPVHSEPVKDEDA

LEPQVKGSSNTSDRDLAGELDKDETVPENDQIKQAAFQLISQVILEATEEFRATTVGKTVAQVHPTSATQPKGKEESCVPASQETSLGQDTSDPASTRTG

ATASPSAEALPPKTYVSCLSSPLSGPTKDQKPKNSAHHISLAPCPPPVTPQRQSLEGASNPRGDDNFVACMANNSQSVLSVSSLGQCSDPVSTSGLEDSC

TETISSSGDKAMTPPLPVSTQPFSNGVLKEELSDLGTEDGWTMDTEADHSGV - UNI9298 - - UNI29476 - VAAPPQERGHFGNGGCTGFFEC


For any suggestions or comments, please send an email to unitrap@crg.es