Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000018501 (Ncor1)
Chromosomal location
Chr 11: 62130192 - 62270834 (-)
Description
nuclear receptor co-repressor 1 Gene [Source:MGI (curated);Acc:Ncor1-001]
RefSeq_peptide
NP_035438.2 
UniGene
Mm.365706 Mm.437515 
MGI
MGI:1349717 
Uniprot/SWISSPROT
Q60974 
Uniprot/SPTREMBL
Q8BK32 Q5RIN0 Q5RIM8 Q3UV08 Q3UWZ3 Q9CUV3 Q5ND01 Q8CHB6 Q8VDE8 Q05C35 Q05CF0 Q5RIM5 Q5RIN1 Q3UV34 Q5RIM6 
Human Ortholog
ENSG00000141027 (NCOR1)
Omim not available
UniTrap UNI468
Vector Insertion
Chr 11: 62252018 - 62270649
Public Clones (sanger) DC0004 (sanger) P098H03 (ggtc) D069C09 (ggtc) D003H12 (ggtc)
5SD030H05 (ggtc) E086A04 (ggtc) D035C10 (ggtc) P136F12 (ggtc) D109H03 (ggtc)
D024E04 (ggtc) E120F04 (ggtc) E064E09 (ggtc) D026E06 (ggtc) D010B09 (ggtc)
5SE307G01 (ggtc) D036C11 (ggtc) IST14222B12 (tigm) IST13666C5 (tigm)
IST11820G4 (tigm) IST11364A10 (tigm) IST14215G7 (tigm) IST10103D4 (tigm)
IST11975B4 (tigm) IST14193G2 (tigm) IST15066A4 (tigm) IST14980E10 (tigm)
IST11382C12 (tigm) IST14479D9 (tigm) IST14416H3 (tigm) IST14433A5 (tigm)
Private Clones OST449025 (lexicon) OST440699 (lexicon) OST374744 (lexicon) OST339974 (lexicon)
OST314367 (lexicon) OST303411 (lexicon) OST303133 (lexicon) OST301234 (lexicon)
OST280052 (lexicon) OST270024 (lexicon) OST263565 (lexicon) OST260198 (lexicon)
OST232413 (lexicon) OST226359 (lexicon) OST222602 (lexicon) OST222363 (lexicon)
OST220309 (lexicon) OST215283 (lexicon) OST214035 (lexicon) OST212603 (lexicon)
OST210165 (lexicon) OST206553 (lexicon) OST202242 (lexicon) OST194402 (lexicon)
OST194326 (lexicon) OST194232 (lexicon) OST192641 (lexicon) OST184475 (lexicon)
OST174996 (lexicon) OST165414 (lexicon) OST163371 (lexicon) OST153121 (lexicon)
OST149662 (lexicon) OST146827 (lexicon) OST104718 (lexicon) OST96782 (lexicon)
OST94313 (lexicon) OST85883 (lexicon) OST78900 (lexicon) OST77941 (lexicon)
OST77077 (lexicon) OST68960 (lexicon) OST65868 (lexicon) OST58318 (lexicon)
OST43506 (lexicon) OST34134 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3377
Vector Insertion
Chr 11: 62251839 - 62252018
Public Clones XR0267 (sanger) W247A08 (ggtc) Q022D03 (ggtc) W264F02 (ggtc) Q022A04 (ggtc)
(ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17971
Vector Insertion
Chr 11: 62247064 - 62247202
Public Clones not available
Private Clones OST432667 (lexicon) OST393129 (lexicon) OST323175 (lexicon) OST304360 (lexicon)
OST266223 (lexicon) OST262165 (lexicon) OST260641 (lexicon) OST258336 (lexicon)
OST251954 (lexicon) OST247956 (lexicon) OST218767 (lexicon) OST217060 (lexicon)
OST201872 (lexicon) OST190416 (lexicon) OST181903 (lexicon) OST179387 (lexicon)
OST175146 (lexicon) OST151465 (lexicon) OST129899 (lexicon) OST126112 (lexicon)
OST116576 (lexicon) OST104771 (lexicon) OST94283 (lexicon) OST90498 (lexicon)
OST53825 (lexicon) OST45305 (lexicon) OST45252 (lexicon) OST35086 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14267
Vector Insertion
Chr 11: 62247064 - 62251991
Public Clones (sanger) E080D12 (ggtc) E079D12 (ggtc) E128F12 (ggtc) D127G03 (ggtc)
FHCRC-GT-S12-1C1 (fhcrc) FHCRC-GT-S21-4F1 (fhcrc) IST14140E9 (tigm)
IST12822D9 (tigm) IST14873E1 (tigm) IST11916F1 (tigm) IST11318C3 (tigm)
IST11606E1 (tigm) IST13144A9 (tigm) IST10556A1 (tigm) IST12433A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2063
Vector Insertion
Chr 11: 62236570 - 62247064
Public Clones (sanger) XT0854 (sanger) XF501 (baygenomics) CSI568 (baygenomics) XE022 (baygenomics)
CSD100 (baygenomics) M053F04 (ggtc) E047E06 (ggtc) D107B09 (ggtc)
P098H10 (ggtc) E089E04 (ggtc) D154D04 (ggtc) D065C11 (ggtc) W255C03 (ggtc)
E065H03 (ggtc) D143H03 (ggtc) D030H02 (ggtc) Q016C08 (ggtc) E040E04 (ggtc)
D098G02 (ggtc) P065F03 (ggtc) E088B03 (ggtc) W275D06 (ggtc) E065H02 (ggtc)
D126H04 (ggtc) E138H05 (ggtc) E039F07 (ggtc) M121E11 (ggtc) CMHD-GT_421B11-3 (cmhd)
CMHD-GT_460G10-3 (cmhd) PST24862-NR (escells) PST20129-NR (escells) IST10104C1 (tigm)
IST13572B1 (tigm) IST10053B3 (tigm) IST14841H2 (tigm) IST14654B3 (tigm)
IST10828G3 (tigm) IST10881A7 (tigm) IST12356G1 (tigm) IST12561B6 (tigm)
IST11105F8 (tigm) IST13595F3 (tigm) IST14680A4 (tigm) IST12671C10 (tigm)
IST14377D4 (tigm) IST14993D3 (tigm) IST11069A3 (tigm) IST11079F12 (tigm)
IST14546D9 (tigm) IST12356E2 (tigm) IST10439B4 (tigm) IST14672C6 (tigm)
IST11802H4 (tigm)
Private Clones OST459655 (lexicon) OST455345 (lexicon) OST448435 (lexicon) OST431177 (lexicon)
OST364907 (lexicon) OST360987 (lexicon) OST357073 (lexicon) OST339944 (lexicon)
OST328604 (lexicon) OST325459 (lexicon) OST323314 (lexicon) OST298689 (lexicon)
OST271922 (lexicon) OST266170 (lexicon) OST259745 (lexicon) OST246149 (lexicon)
OST243044 (lexicon) OST236405 (lexicon) OST230362 (lexicon) OST230333 (lexicon)
OST223863 (lexicon) OST217584 (lexicon) OST217542 (lexicon) OST214856 (lexicon)
OST214167 (lexicon) OST186472 (lexicon) OST175553 (lexicon) OST172626 (lexicon)
OST147738 (lexicon) OST128007 (lexicon) OST125243 (lexicon) OST123349 (lexicon)
OST113561 (lexicon) OST98373 (lexicon) OST86108 (lexicon) OST79192 (lexicon)
OST68274 (lexicon) OST68077 (lexicon) OST56081 (lexicon) OST46549 (lexicon)
OST45449 (lexicon) OST44850 (lexicon) OST38563 (lexicon) OST37542 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10810
Vector Insertion
Chr 11: 62236376 - 62236570
Public Clones D027A12 (ggtc) D017H12 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14658
Vector Insertion
Chr 11: 62233099 - 62236570
Public Clones FHCRC-GT-S2-9E1 (fhcrc)
Private Clones OST372863 (lexicon) OST339243 (lexicon) OST246229 (lexicon) OST244968 (lexicon)
OST233462 (lexicon) OST224297 (lexicon) OST223132 (lexicon) OST222311 (lexicon)
OST217559 (lexicon) OST210790 (lexicon) OST203268 (lexicon) OST202367 (lexicon)
OST69562 (lexicon) OST62104 (lexicon) OST59954 (lexicon) OST53605 (lexicon)
OST45013 (lexicon) OST44628 (lexicon) OST43693 (lexicon) OST43605 (lexicon)
OST43416 (lexicon) OST43379 (lexicon) OST43378 (lexicon) OST43153 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4769
Vector Insertion
Chr 11: 62233099 - 62233283
Public Clones AW0619 (sanger) CSG077 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18571
Vector Insertion
Chr 11: 62224436 - 62233099
Public Clones IST11627F10 (tigm)
Private Clones OST420459 (lexicon) OST44789 (lexicon)
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16829
Vector Insertion
Chr 11: 62217969 - 62224321
Public Clones not available
Private Clones OST453578 (lexicon) OST326168 (lexicon) OST319174 (lexicon) OST145761 (lexicon)
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4983
Vector Insertion
Chr 11: 62217911 - 62217969
Public Clones AA0071 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27659
Vector Insertion
Chr 11: 62214770 - 62216937
Public Clones not available
Private Clones OST54339 (lexicon)
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17360
Vector Insertion
Chr 11: 62208731 - 62211766
Public Clones not available
Private Clones OST443946 (lexicon) OST427466 (lexicon) OST37441 (lexicon)
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27605
Vector Insertion
Chr 11: 62206006 - 62206186
Public Clones not available
Private Clones OST55416 (lexicon)
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28761
Vector Insertion
Chr 11: 62203295 - 62204480
Public Clones not available
Private Clones OST21213 (lexicon)
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4061
Vector Insertion
Chr 11: 62203192 - 62203295
Public Clones AQ0040 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18956
Vector Insertion
Chr 11: 62198219 - 62198345
Public Clones not available
Private Clones OST408884 (lexicon)
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32153
Vector Insertion
Chr 11: 62198219 - 62203295
Public Clones IST12575D12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6689
Vector Insertion
Chr 11: 62194909 - 62194973
Public Clones BGC413 (baygenomics) F15258 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35837
Vector Insertion
Chr 11: 62190136 - 62192157
Public Clones (cmhd) IST14768G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35716
Vector Insertion
Chr 11: 62180465 - 62182926
Public Clones IST13660A1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9235
Vector Insertion
Chr 11: 62180445 - 62180662
Public Clones XG753 (baygenomics) RRC256 (baygenomics) A024A07 (ggtc) A025A04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27108
Vector Insertion
Chr 11: 62168191 - 62172356
Public Clones 5SE305E07 (ggtc) 3SE305E07 (ggtc) IST14952B7 (tigm) IST13691D3 (tigm)
Private Clones OST70175 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26134
Vector Insertion
Chr 11: 62167975 - 62168072
Public Clones not available
Private Clones OST135391 (lexicon) OST100705 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20028
Vector Insertion
Chr 11: 62166837 - 62167884
Public Clones not available
Private Clones OST374722 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20330
Vector Insertion
Chr 11: 62164879 - 62165049
Public Clones not available
Private Clones OST367093 (lexicon) OST168954 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12079
Vector Insertion
Chr 11: 62162996 - 62164879
Public Clones A035C05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22523
Vector Insertion
Chr 11: 62158821 - 62162854
Public Clones not available
Private Clones OST293295 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7679
Vector Insertion
Chr 11: 62156854 - 62158133
Public Clones RRS100 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29379
Vector Insertion
Chr 11: 62152571 - 62153909
Public Clones Ayu18-51 (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI290
Vector Insertion
Chr 11: 62152571 - 62153909
Public Clones GC0749 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2493
Vector Insertion
Chr 11: 62144427 - 62147164
Public Clones XT0350 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5550
Vector Insertion
Chr 11: 62138988 - 62139132
Public Clones CSH681 (baygenomics) YTA138 (baygenomics) F015F02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI160
Vector Insertion
Chr 11: 62131533 - 62132867
Public Clones GC0153 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27798
Vector Insertion
Chr 11: 62130191 - 62131533
Public Clones not available
Private Clones OST47817 (lexicon) OST47814 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000069456
Sequence
GGAGTGGGGTTGAGGCAAGATGGCGGCTAAGGTGGCGAAGCTGCGGCGGCGGCGGCTGGAGTGAGCGCCCAGCTCGCCGCGCTGCCGAGCGAGGGCCGGG

CGGAGGGCCGCGCGCCGGGGCCGCGCCCCGGTCGTCCGGCCGTGGGGCGCGCCGGCTCTCACTCCGCCAGCTCCCG - UNI468 - - UNI3377 - 

GTTGCTTCCTAGAAACATGGTTGTTTGTTGGACTTGATCTCACAGCCCAGTGAGGACGTCTTTACTGATAATGTCAAGTTCAGGTTACCCTCCCAACCAA

GGAGCTTTCAGCACAGAGCAAAGTCGTTATCCTTCACATTCTGTCCAGTATACCTTTCCCAGTACCCGACACCAGCAG - UNI3377 - - UNI1426

7 - - UNI17971 - GAATTTGCAGTTCCTGACTACCGCTCTTCTCATATTGAAGTTAGCCAGGCATCACAGCTTTTACAGCAGCAGCAGCAGCAGCA

GCAGCTTCGAAGACGACCTTCCTTGCTTTCAGAATTTCACCCGGGTTCTGACAG - UNI2063 - - UNI10810 - - UNI14267 - - UNI14

658 - - UNI17971 - GCCTCAAGAAAGGAGAACTGGATATGAACAGTTTCACTCAGGACCCTCACCGGTGGATCATGATTCCTTGGAGTCCAAGCG

CCCACGCCTGGAGCCAGTTTCTGATGCCCATTTCCAGCGTGTTAGTGCTGCGGTTTTACCTTTAGTTCACTCGCTGCCAGAAGGCTTGAGGTCGTCTGCA

GATGCTAAGAAG - UNI4769 - - UNI10810 - - UNI14658 - GATTCAGCATTTGGAAGCAAACATGAAGCTCCATCCTCTCCTTTGGCTG

GGCAACCATGTGGAGATGACCAAAATGCTTCACCTTCAAAGCTTTCAAAGGAGGAGTTAATACAGAGTATGGACCGGGTAGACCGAGAGATTGCAAAAGT

AGAGCAGCAGATCCTTAAATTGAAAAAGAAACAA - UNI4769 - - UNI14658 - - UNI18571 - CAACAGCTAGAAGAAGAAGCAGCTAAG

CCCCCTGAACCAGAGAAGCCTGTGTCCCCTCCTCCTGTGGAACAAAAACACCGTAGTATTGTCCAAATTATTTATGATGAGAATCGG - UNI4983 - 

- UNI16829 - AAAAAAGCAGAAGAAGCTCATAAAATATTTGAAGGTCTTGGCCCAAAAGTTGAACTG - UNI4983 - CCACTCTATAACCAGCC

ATCAGATACCAAGGTGTACCATGAGAACATCAAGAC TGGAGTACCTGCAAGGCGCATGATGAAGTAAGATAATGAAGCTTTTTCATTTAAGACTAGTGA

TGACACCGTCCCCCACCAAGCCACATCTGCCATTGCAAAGTAGAAGTGCCACGGATCATTTTATCATTATTCAAAACCCTATTCTAGGGAAATCCCTTCC

ATGACTCTTGCTAATGACGGTATTTGTAGACCCTTCTGCCATTTAATGTCCTGGTGCCTTGGAAGGCTCAGTCCCCTCATGTGGGTGAGGAGGCTGTTCC

AGAATGTAGTTTGCTTTGCCTTGCTCATCCTAGTACCAGGCCTTTTATGGATGCAGATCTTGGAATAAGAAAATAAGTGAAAAATGAACTTAATTTCTTG

ATCTGATTGAAGTAAGAGAAGCTAGATAGGCTTTTTTTTAAAAAAAAATTGTTGTTTAATTATCATACTTTTAGAGAATTTTAGGTGAAGTATTAACAGT

TGGTGACAAAAATGTGATATTTCTATTTATTTGCATTTAAAAGTATATCAGAACCTAAAATGATTTACTATTACAGTTACTAATGAGCACATTATTTATA

TTTTTCCTTTTACGTTCTGAGAATGTGTACAATAATTGACTACTTTGCAGAACTGGTGGCAAATATATGTGCATGGTAGTATGCATGACTATTACAATTT

AGTCATTTTAATTTCTGTTAAGTATGTAGTTCATAATTAAAGTCATCTATTTAAGAATTTTTTCTGTGAGATATTGCCATGGTCTTGAGACCCTTTAAGA

GGACATTAGGCTGAACTCATAAAATACATTTTGATTTAGAACTACTTAGCTGTTTAATGTTTTTAAAAGGAGGATACCAGATATAATTTCGTTGGCTATT

TTCAGTGATTTACCCCCAAAGCTTCAGTTTGTGTTTTGTCTTCTCCCCTCAATGTAAGCTGGGAAGCTGCACTGTTTGATGATTTTCTGTCCTCCACATT

GCTTGTGTTAGACTGTGCTGAGATGGGTTACTGACTAGCTGACTTCACTTAAGTTCTTAGTAAACATTGAACATTTTATTTACTAGGTGACATTTATTTT

TGAGTAGCATATAATTGCAATAAGAATAAATTGGCAGCTGGGCATGGTGGCGCACACCTTTAATCCCAGCACTTGGGAGGCAGAGGCAGGCGGATTTCTG

AGTTCGAGGCCAGCCTGGTCTACAGAGTGAGTTCCAGGACAGCCAGGGCTTCAGAGAAACCCTGTCTCAAAAAACAAAACAAAACCAAAAAAACAAAAAC

AAACAAAACAAAAAAGGAAGAAGAATAAATTGGCATGTGGTGACGGTCCTACTGTATGTTACATTTGAAATACTCAGATGCACACATTTTCAAAAAGCTT

TCAGTAGCTAGTCACCAATCTTTGCTTTGTATGAAATACCAAGTGTGCCTTTTAAAAATTCTGTCTCTTGACTGCTTTGTCATACTGCCAGCTACTGATT

GTCTATGCATATTTGAGTGAAGCCAGTGTTGTCGTTAGTCCTGAGTGACAGATAATCCATGAATTTATTTCTACTTTCATTGACTTTGTATTTATGTCTG

AATAATCAACTTACAGTTATTTCTGGAAGTAGGTGGGGTATAAATATTTATATATTTGAAACCTGCATGATGTTGTTTTAGAAGATCACAGTGCTTCCAA

CTTAAAAAGTGGTGATGTTACATTAAGACATGTGAGAAAATCTTCTGTCTTGTCAGATTGTTGCTCCATAGAGTCTGTTGTATCATATCTGTGGAAGAGA

AATCTTCTGTTTTGAGCAGAAGTCACCTCTTTGTAAATATGTTGGTGTGCATTCTCCTTTCACGAGGGAAGTACCTGCTAAAGGTTTCTTTTCCCTTTTA

CTTCCCTTTCTCAGTATATTCAAAGATGCTTGTATCATCAGAATTCTTAAGAATTAGTTACCCCTTAATTATAATTTGAAAATAATGTCTTAAAATCAGA

TGCATGAATTAAAAATTAACTGTATTATCTTGTTATAGAATGGCAGGAATTTTAGTCCTAATTGGAAAAATTATGGAGTTTTATTTTGCAGGTTGAAAAA

TAAATTAAGATTAACTC
Translation
 - UNI468 - - UNI3377 - MSSSGYPPNQGAFSTEQSRYPSHSVQYTFPSTRHQQ - UNI3377 - - UNI14267 - - UNI17971 - E

FAVPDYRSSHIEVSQASQLLQQQQQQQQLRRRPSLLSEFHPGSDR - UNI2063 - - UNI10810 - - UNI14267 - - UNI14658 - - U

NI17971 - RPQERRTGYEQFHSGPSPVDHDSLESKRPRLEPVSDAHFQRVSAAVLPLVHSLPEGLRSSADAKK - UNI4769 - - UNI10810 -

 - UNI14658 - DSAFGSKHEAPSSPLAGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQ - UNI4769 - - UNI14658 -

 - UNI18571 - QQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENR - UNI4983 - - UNI16829 - KKAEEAHKIFEGLGPKVEL - 

UNI4983 - PLYNQPSDTKVYHENIKT TGVPARRMMK
Transcript ENSMUST00000101066
Sequence
GAGGGGGAGGGAGTGGGGTTGAGGCAAGATGGCGGCTAAGGTGGCGAAGCTGCGGCGGCGGCGGCTGGAGTGAGCGCCCAGCTCGCCGCGCTGCCGAGCG

AGGGCCGGGCGGAGGGCCGCGCGCCGGGGCCGCGCCCCGGTCGTCCGGCCGTGGGGCGCGCCGGCTCTCACTCCGCCAGCTCCCG - UNI468 - - U

NI3377 - GTTGCTTCCTAGAAACATGGTTGTTTGTTGGACTTGATCTCACAGCCCAGTGAGGACGTCTTTACTGATAATGTCAAGTTCAGGTTACCCT

CCCAACCAAGGAGCTTTCAGCACAGAGCAAAGTCGTTATCCTTCACATTCTGTCCAGTATACCTTTCCCAGTACCCGACACCAGCAG - UNI3377 - 

- UNI14267 - - UNI17971 - GAATTTGCAGTTCCTGACTACCGCTCTTCTCATATTGAAGTTAGCCAGGCATCACAGCTTTTACAGCAGCAGCA

GCAGCAGCAGCAGCTTCGAAGACGACCTTCCTTGCTTTCAGAATTTCACCCGGGTTCTGACAG - UNI2063 - - UNI10810 - - UNI14267 

- - UNI14658 - - UNI17971 - GCCTCAAGAAAGGAGAACTGGATATGAACAGTTTCACTCAGGACCCTCACCGGTGGATCATGATTCCTTGGA

GTCCAAGCGCCCACGCCTGGAGCCAGTTTCTGATGCCCATTTCCAGCGTGTTAGTGCTGCGGTTTTACCTTTAGTTCACTCGCTGCCAGAAGGCTTGAGG

TCGTCTGCAGATGCTAAGAAG - UNI4769 - - UNI10810 - - UNI14658 - GATTCAGCATTTGGAAGCAAACATGAAGCTCCATCCTCTC

CTTTGGCTGGGCAACCATGTGGAGATGACCAAAATGCTTCACCTTCAAAGCTTTCAAAGGAGGAGTTAATACAGAGTATGGACCGGGTAGACCGAGAGAT

TGCAAAAGTAGAGCAGCAGATCCTTAAATTGAAAAAGAAACAA - UNI4769 - - UNI14658 - - UNI18571 - CAACAGCTAGAAGAAGAA

GCAGCTAAGCCCCCTGAACCAGAGAAGCCTGTGTCCCCTCCTCCTGTGGAACAAAAACACCGTAGTATTGTCCAAATTATTTATGATGAGAATCGG - U

NI4983 - - UNI16829 - AAAAAAGCAGAAGAAGCTCATAAAATATTTGAAGGTCTTGGCCCAAAAGTTGAACTG - UNI4983 - CCACTCTA

TAACCAGCCATCAGATACCAAGGTGTACCATGAGAACATCAAGAC TGGAGTACCTGCAAGGCGCATGATGAA - UNI27659 - AAACCAGGTGATG

AGGAAAAAACTCATTTTATTTTTTAAAAGAAGAAATCATGCAAGAAAACAAAGG GAACAAAAAATCTGCCAGCGCTATGATCAGCTCATGGAAGCGTGG

GAGAAAAAAGTGGACAGAATAGAAAATAATCCCCGGAGGAAAGCAAAAGAAAGCAAAACAAGGGAATACTATGAGAAGCAGTTTCCAGAAATTCGAAAAC

AAAGAGAACAGCAAGAAAGATTTCAGCG - UNI17360 - AGTTGGTCAGAGGGGAGCTGGTCTTTCAGCCACCATTGCTAGGAGTGAGCATGAGATT

TCTGAAATTATTGATGGTCTTTCTGAACAGGAG - UNI27605 - AATAATGAGAAGCAAATGCGTCAGCTTTCTGTGATTCCACCTATGATGTTTGA

TGCAGAACAAAGAAGGGTCAAATTCATCAATATGAATGGGCTGATGGAGGATCCAATGAAGGTTTATAAAGACAGACAGTTTATGAATGTTTGGACTGAC

CATGAAAAGGAGATCTTTAAGGACAA - UNI27605 - GTTTATCCAGCATCCAAAAAACTTTGGACTAATTGCATCCTATTTGGAAAGGAAG - UN

I4061 - - UNI28761 - - UNI32153 - AGTGTTCCTGATTGTGTTTTATATTACTATTTAACCAAGAAAAATGAGAATTATAAGGCCCTCGTG

AGAAGGAATTATGGAAAACGCAGAGGCAGAAATCAG - UNI4061 - - UNI18956 - - UNI32153 - CAGATTGCCCGTCCCTCACAAGAAG

AAAAAGTAGAAGAAAAGGAAGAGGATAAAGCAGAAAAAACAGAGAAAAAGGAAGAAGAAAAGAAGGATGATGAAGAAAAAGATGATAAGGAAGACTCTAA

 - UNI18956 - - UNI32153 - AGAAACAACCAAGGAAAAGGACAGAACGGAAGCCACAGCAGAAGAACCTGAAGAAAGAGAGCAGGTCACTCCA

AGGGGGCGAAAGACTGCTAACAGCCAAGGCCGCCGGAAGGGCCGGGTCACCAGGTCGATGACAAGTGAAGCTGCAGCTGCCAATGCTGCTGCTGCAGCCA

CTGAGGAGCCCCCGCCACCCCTGCCGCCACCACCAGAGCCCA - UNI6689 - TTTCTACAGAACCTGTTGAGACTTCAAGATGGACAGAAGAAGAAA

TGGAAGTTGCTAAAAAAG - UNI6689 - GCCTGGTAGAACATGGTCGTAACTGGGCAGCCATTGCTAAAATGGTGGGAACTAAAAGTGAAGCCCAGT

GCAAAAACTTCTATTTTAACTATAAAAGACGGCATAATCTTGACAACCTTTTGCAGCAACATAAACAGAAAGTGAGTAGAGCAGTAGTG GCTTCACGGA

AACCCCGTGAGGAACGAGATGTATCTCAGTGTGAAAGTGTTGCTTCCACTGTTTCTGCCCAAGAGGATGAAGATATTGAAGCCTCAAATGAGGAGGAAAA

TCCAGAAGATAGTGAAG GTGCTGAAAATAGTTCTGATACAGAAAGTGCTCCCTCTCCTTCACCAGTTGAAGCTGCCAAGTCCAGTGAAGACAGCAGTGA

AAATGCTGCTTCTCGAGGAAACACCGAGCCTGTGGCTGAGCTTGAGGCCACCACTGACCCTGCACCCTGTGCATCTCCCTCTTCAGCAGTTCCAACCACA

AAACCAGCAGAAAGGGAAAGCGTGGAGGCCCAGGTGACCGACAGCGCCAGTGCTGAGACCGCAGAGCCGATGGACGTAGACCATGAGGAGTGCGGTGCCG

AGGGCAGTTCTGTTCTTGATCCACCAGCCCCTACCAAAGCCGACTCCGTGGACCCAGAAATGCAGGTACCAGAAAATACTGCGTCTAAAGGTGAAGGGGA

TGCCAAGGAAAGAGACTTGGAGAGCACCAGTGAGAAGACAGAGGCTAGAGATGAAGACGTGGTAGTGGCTGAACAGATCGAGAGGCCTGAGCCACAGTCA

GACGACGACTCCAGTGCCACTTGCAGTGCGGATGAGGGTGTGGATGGAGAGCCAGAGAGGCAGAG AGTGTTTCCCATGGATGCAAAGCCTTCATTGTTA

ACTCCTCCTGGATCTATCCTAATCTCATCCCCTATTAAACCAAACCCATTGGATCTGCCACAGCTTCAGCATCGAGCTGCTGTTATTCCACCAATG - U

NI9235 - GTTTCTTGCACTCCATGTAATATACCAATTGGAACGCCCGTAAGTGGCTATGCTCTTTACCAACGGCACATTAAGGCCATGCATGAGTCAG

CACTCCTGGAGGAGCAGCGGCAGAGGCAAGAACAGGTAGACTTGGAATGCAGAAGCTCTACAAGCCCATGCAGCACTTCTAAGAGTCCAAACAGGGAGTG

GGAAG - UNI9235 - TCCTCCAACCTGCTCCGCATCAAGTGATAACTAACCTTCCTGAAGGGGTTCGGCTTCCAACAACACGACCAACCAGGCCACC

ACCTCCCCTCATCCCATCATCTAAAACCACAGTGGCATCAGAAAAACCATCCTTTATAATGGGAGGGTCTATCTCACAG - UNI27108 - GGAACTC

CTGGCACTTACTTGTCTTCTCATAATCAGGCTTATCCACAAGAAGCCCCTAAGCCCTCCGTGGGGTCTATCTCTCTGGGATTGCCCCGGCAGCAGGAGTC

TACCAAAGCAG - UNI26134 - CTCCTTTGACCTACATCAAGCAGGAAGAATTTTCTCCGAGAAGCCAAAACTCACAACCTGAGGGTTTATTGGTCA

GAGCGCAGCATGAAG - UNI20028 - GCACTGCAGGGGCTGTCCAAGAAGGAAGTATAACTCGGGGAACTCCAGCCAGCAAAATCTCAGTGGAGACC

ATTTCATCGTTGCGGGGCTCTATTACCCAG - UNI20330 - GGGACCCCAGCTCTGCCCCAGGCTGGAATACCAACAGAGGCTTTGGTGAAGGGACC

TGTCTCCAGGATGCCTATTGAAGAAAGCAGTCCTGAGAAGGTCAGAGAGGAAGCTGCATCCAAGGGCCATGTTATCTATGAAGGCAAAAGTGGACATATC

TTATCATATGATA - UNI12079 - - UNI20330 - ATATTAAGAATGCCCGAGAAGGGACTCGGAGTCCAAGAACAGCTCATGAAATGAGTTTAA

AAAGAAGCTATGAGGCAGTGGAAGGAAGTATAAAGCAAG - UNI22523 - GTCTGATATGCCGAGCATTACCCAGGGGGAGCCCTCATTCTGACCTC

AAAGAGAGGACTGTGCTGTCTGGTTCCATAATGCAGG GCACACCAAGAGCCACAGCGGAAAGCTTTGAGGACGGCCTTAAATACCCCAAACAGATAAAA

AGGGAGAGCCCTCCCATCCGAGCATTTGAAGGTGCCATTACCAAAGGAAAACCATACGATGGTATCACCACCATCAAAGAAATGGGGCGCTCCATCCATG

AAATCCCACGGCAAGATATTCTAACTCAGGAAAGCCGGAAAACTCCAGAAGTGGTCCAGAGCACGAGGCCAATAATTGAGGGTTCCATTTCCCAG - UN

I7679 - GGCACACCAATAAAATTTGACAACAACTCAGGTCAATCAGCTATCAAACACAATGTGAAGTCCTTAATCACAGGGCCTAGCAAACTACCCCG

TGGAATGCTGGAAATTGTACCAGAGAACATAAAAGTAGTAGAACGGGGAAAATATGAGGATGTGAAAGCAGGCGAGCCAGTGCGAGCCCGGCACACGTCA

GTGGTGAGCTCTGGCCCCTCCGTTCTCAGGTCTACACTTCACGAAGCTCCCAAAGCACAGCTGAGCCCGGGACTCTATGATGACAGCAGCGCTCGCAGGA

CTCCTGTGAGCTACCAGAACACCATATCCAGAGGCTCCCCCATGATGAACAGAACTTCTGATG TTTCTTCCAGCAAGTCTGCCAGTCATGAAAGGAAAT

CAACTCTGACCCCAACCCAAAGAGAAAGTATACCAGCCAAGTCTCCAGTGCCCGGGGTGGATCCCGTCGTGAGTCACAGCCCATTTGATCCTCATCACAG

GAGTAGCGCTGCAGGAGAGGTTTATCGGAGCCACCTACCCACGCACTTGGATCCAGCTATGCCCTTTCACAGGGCTTTGGATCCTG - UNI290 - - 

UNI29379 - CAGCTGCTGCTTACCTGTTACAGAGACAGCTTTCACCAACCCCAGGATACCCAAGTCAGTACCAGCTCTATGCAATGGAGAATACAAGG

CAGACAATCCTCAACGATTACATTACCTCACAGCAGATGCAGGTGAATCTGCGCCCTGATGTCACCAGGGGACTGTCCCCACGAGAGCAGCCACTGGGGC

TCCCTTACCCAGCTACAAGAG GAATCATTGACCTGACCAATATGCCTCCAACAATCTTAGTGCCTCATGCAGGGGGAACGAGCACCCCTCCCATGGACA

GGATCACGTATATTCCTGGTACACAGGTTACTTTCCCTCCCAGGCCATATAACGCTGCTTCTCTGTCTCCAG GACACCCAACACACCTTGCAGCAGCTG

CAAGTGCTGAGAGGGAACGAGAGCGGGAAAGGGAGAAGGAGCGCGAACGTGAGCGCGAGCGTGAGCGTGAACGTGAACGCGAAAGGATCGCTGCTGCTCC

CGCTGACCTCTACCTACGACCAG GTTCAGAACAGCCAGGCCGTCCTGGCAGCCACGGATATGTTCGCTCCCCTTCCCCTTCAGTAAGAACTCAGGAGAC

CATCCTGCAACAGAGACCCAGTGTTTTCCAGGGCACCAATGGAACCAGTGTAATCACACCTTTGGACCCAACTGCTCAGCTACGCATCAT GCCACTGCC

TTCTGGGGGCCCTTCCATAAGTCAAGGCCTGCCAGCCTCCCGTTACAACACTGCTGCGGATGCCCTGGCTGCTCTTGTGGATGCTGCAGCTTCTGCACCC

CAGATGGATGTTTCCAAAACAAAAGAGAGTAAGCATGAAGCTGCCAGGTTAGAAGAAAATTTGAGAAGCAGGTCAGCAGCAGTTAGTGAACAGCAGCAGC

TAGAGCAGAAAAACCTGGAGGTGGAGAAGAGATCTGTTCAGTGTGTGTGCACTTCTTCAGCCCTTCCAAGTGGCAAGGCCCAGCCTCATGCCTCAGTAGT

GTATTCTGAGGCTGGGAAAGATAAAGGGCCTCCTCCAAAATCCAGATATGAGGAAGAGCTAAGGACCCGAGGGAAGACTACCATTACTGCAGCTAACTTC

ATAGACGTGATCATCACCCGGCAAATTGCCTCGGACAAGGATGCGAGGGAACGTGGCTCTCAAAGTTCAGACTCTTCTAGTAGCT - UNI2493 - TG

TCTTCTCACAGGTATGAAACGGCTAGTGATGCCATTGAGGTGATAAGTCCCGCCAGCTCACCTGCACCACCCCAGGAAAAGCCACAGGCCTATCAGCCAG

ACATGGTTAAGGCAAATCAAGCAGAAA ATGAGTCCACTCGACAGTATGAAGGTCCACTGCATCATTATCGGTCCCAGCAGGAATCACCATCTCCACAGC

AACAGCCACCACTGCCCCCATCTTCCCAGTCAGAGGGAATGGGACAGGTGCCCAGGACCCATCGACTGATCACACTTGCTGACCACATCTGT CAAATTA

TCACACAAGATTTTGCTAGAAATCAAGTTCCCTCGCAGCCTTCTACTTCTACATTCCAAACTTCACCATCTGCTTTGTCATCCACACCTGTAAGAACTAA

AACCTCAAGCCGCTACAGCCCAGAATCACAGTCTCAGACTGTCTTGCATCCCAGACCAGGTCCTAGAGTCTCTCCAGAAAATCTTGTGGATAAATCCCGG

GGAAG CAGGCCTGGAAAATCTCCAGAGAGGAGTCATATCCCATCAGAGCCCTATGAGCCCATCTCCCCACCCCAAGGCCCTGCTGTGCATGAGAAGCAG

GACAGCATGTTGCTCTTGTCACAGAGGGGAGTGGACCCTGCTGAGCAAAG - UNI5550 - GAGTGATTCTCGATCACCAGGAAGTATAAGCTACTTG

CCTTCATTCTTCACCAAGCTTGAAAGCACATCACCCATGGTTAAATCAAAGAAACAGGAAATTTTTCGTAAGTTGAACTCTTCTGGTGGAGGTGACTCTG

ATATGG - UNI5550 - CAGCTGCTCAGCCAGGAACAGAGATCTTCAATCTGCCAGCAGTTACCACATCAG GTGCAGTGAGCTCAAGAAGCCATTCT

TTTGCTGATCCCGCCAGTAACCTTGGTCTAGAAGACATCATCAGAAAGGCTCTCATGGGAAGTTTTGATGATAAAGTTGAAGATCATGGTGTTGTCATGT

CCCATCCTGTGGGCATTATGCCTGGTAGTGCCAGCACCTCAGTGGTGACGAGCAGCGAGGCACGGAGAGATGAAGGGGAGCCATCACCTCATGCAG GAG

TATGCAAACCAAAGCTGATCAACAAATCAAACAGCAGGAAGTCTAAATCTCCTATTCCTGGGCAAAGCTATTTAGGAACTGAAAGGCCTTCTTCTGTCTC

CTCTGTGCATTCAGAAGGTGATTACCACAGGCAGACACCAGGATGGGCATGGGAAGATCGGCCCTCTTCAACAG - UNI160 - - UNI27798 - G

TTCTACTCAGTTCCCTTACAACCCTCTGACCATACGGATGCTCAGCAGTACACCACCTACACAGATCGCATGCGCCCCATCTGCCATCACCCAAGCAGCT

CCACATCAACAGAACCGCATCTGGGAGAGGGAGCCTGCCCCGCTCCTCTCAGCGCAGTATGAGACACTGTCTGATAGTGACGACTGAGCTGTGCGTGGGA

GAGCGCTCTGGCTTTGGTTTTTATTGAAGATTTAAAAAAAAAAAAAGAAAATTATTCTGCCCTCCCATGATTTGTGCCCAGAGACTTCTCAGGAGAGCCA

GGGCCATGGATGAGGAAGAAATGATGGAAATTCATTTGGAAAATCAAATGGGAAAAAACAAACAAAAAAACTGCCTCTAATACAGGCACTTCAATGGATT

ATAACAGTGGCGGGTTGAAGTGTAGAGTTTTTTTAAAGTGGACAATTCTTGTTCTTACATCTGTTTGTAAAGAAAACCATGATGTCTTTAAATCAATCTT

CTGTAAATAGATGACTTTTTTGCAGTGTATCCCCTTGCTGTAGTATCTGGTGTACTTAAATTTAAATCAGCGAATCAACTGGGGAGAATTTTTAAAATTC

TTTGTGTATCTTTTTAACCCCAGCCTCTAAACCTCACACAGCCCAGTTCCACAGTGCTGGCTGTCATGGGCATTGTACTTTTGTTTCCTCTAAATTCAGC

TTTCCCAGTGATGTTTAAATCTTGTGGAAATATTTAGGTTTTTAACACATACCCTGTCATAAAGCCTGTATGAGGTCAGAAGACAGGAGCAACACAACTG

TCATATTGTGAGTTCCAGTGCAGGCTTGGCTTTCATTGGTAGCACTGAAAAAAATTACTGCATGGGTATGTTATAGTTCAGTTTTAAAGTTTAAAGGCTT

TTTTGAGGCATACCTCAATGTTTATGCACACTGGTAATTTAACCACGCCCCCTAAGTATTCTGCATTTGATGCAGCCCAACAAAGCTTCTTTCTGTTCTG

AAATAAATTTTGACTATCCTGTCCATAGCTACAGTACATCATTTGTGACGTAAAGAGTCTTCGTTTCTCAGGTTTCAAACAATTAGTATACATGCTTTTC

TTTAGATACAGAATTGGCGGAGTTAAAAAGAGAACACTGTATAGAACTTTCTGTCTTCCAGGCTTGTTTTTATGCTGCATCGTGAACTGACCGTTGAGCA

CAGTCCTCTGCATCAGTGCCCATTCTCTGCTCCTAGGGAACAGATTCTTAAGGTGCAAGTAATTTAAAGACTGAATTTTAAACTAATTATGGCACTGTAG

GATCACCTTTATTCATTAAGAATTGCTTGCTGTGATTCAG
Translation
 - UNI468 - - UNI3377 - MSSSGYPPNQGAFSTEQSRYPSHSVQYTFPSTRHQQ - UNI3377 - - UNI14267 - - UNI17971 - E

FAVPDYRSSHIEVSQASQLLQQQQQQQQLRRRPSLLSEFHPGSDR - UNI2063 - - UNI10810 - - UNI14267 - - UNI14658 - - U

NI17971 - RPQERRTGYEQFHSGPSPVDHDSLESKRPRLEPVSDAHFQRVSAAVLPLVHSLPEGLRSSADAKK - UNI4769 - - UNI10810 -

 - UNI14658 - DSAFGSKHEAPSSPLAGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQ - UNI4769 - - UNI14658 -

 - UNI18571 - QQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENR - UNI4983 - - UNI16829 - KKAEEAHKIFEGLGPKVEL - 

UNI4983 - PLYNQPSDTKVYHENIKT TGVPARRMMK - UNI27659 - KNQVMRKKLILFFKRRNHARKQR EQKICQRYDQLMEAWEKKVDRIE

NNPRRKAKESKTREYYEKQFPEIRKQREQQERFQR - UNI17360 - RVGQRGAGLSATIARSEHEISEIIDGLSEQE - UNI27605 - NNEKQM

RQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDK - UNI27605 - KFIQHPKNFGLIASYLERK - UNI4061 - 

- UNI28761 - - UNI32153 - SVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQ - UNI4061 - - UNI18956 - - UNI32153 - Q

IARPSQEEKVEEKEEDKAEKTEKKEEE - UNI18956 - - UNI32153 -  - UNI6689 -  - UNI6689 -     - UNI9235 -  - U

NI9235 -  - UNI27108 -  - UNI26134 -  - UNI20028 -  - UNI20330 -  - UNI12079 - - UNI20330 -  - UNI22

523 -   - UNI7679 -   - UNI290 - - UNI29379 -      - UNI2493 -     - UNI5550 -  - UNI5550 -    - UNI

160 - - UNI27798 - 
Transcript ENSMUST00000101068
Sequence
GTTGCTTCCTAGAAACATGGTTGTTTGTTGGACTTGATCTCACAGCCCAGTGAGGACGTCTTTACTGATAATGTCAAGTTCAGGTTACCCTCCCAACCAA

GGAGCTTTCAGCACAGAGCAAAGTCGTTATCCTTCACATTCTGTCCAGTATACCTTTCCCAGTACCCGACACCAGCAG - UNI2063 - - UNI3377

 - - UNI4769 - - UNI10810 - - UNI14267 - - UNI14658 - - UNI17971 - GATTCAGCATTTGGAAGCAAACATGAAGCTCCA

TCCTCTCCTTTGGCTGGGCAACCATGTGGAGATGACCAAAATGCTTCACCTTCAAAGCTTTCAAAGGAGGAGTTAATACAGAGTATGGACCGGGTAGACC

GAGAGATTGCAAAAGTAGAGCAGCAGATCCTTAAATTGAAAAAGAAACAA - UNI4769 - - UNI14658 - - UNI18571 - CAACAGCTAGA

AGAAGAAGCAGCTAAGCCCCCTGAACCAGAGAAGCCTGTGTCCCCTCCTCCTGTGGAACAAAAACACCGTAGTATTGTCCAAATTATTTATGATGAGAAT

CGG - UNI4983 - - UNI16829 - AAAAAAGCAGAAGAAGCTCATAAAATATTTGAAGGTCTTGGCCCAAAAGTTGAACTG - UNI4983 - C

CACTCTATAACCAGCCATCAGATACCAAGGTGTACCATGAGAACATCAAGAC - UNI27659 - AAACCAGGTGATGAGGAAAAAACTCATTTTATTT

TTTAAAAGAAGAAATCATGCAAGAAAACAAAGG GAACAAAAAATCTGCCAGCGCTATGATCAGCTCATGGAAGCGTGGGAGAAAAAAGTGGACAGAATA

GAAAATAATCCCCGGAGGAAAGCAAAAGAAAGCAAAACAAGGGAATACTATGAGAAGCAGTTTCCAGAAATTCGAAAACAAAGAGAACAGCAAGAAAGAT

TTCAGCG - UNI17360 - AGTTGGTCAGAGGGGAGCTGGTCTTTCAGCCACCATTGCTAGGAGTGAGCATGAGATTTCTGAAATTATTGATGGTCTT

TCTGAACAGGAG - UNI27605 - AATAATGAGAAGCAAATGCGTCAGCTTTCTGTGATTCCACCTATGATGTTTGATGCAGAACAAAGAAGGGTCAA

ATTCATCAATATGAATGGGCTGATGGAGGATCCAATGAAGGTTTATAAAGACAGACAGTTTATGAATGTTTGGACTGACCATGAAAAGGAGATCTTTAAG

GACAA - UNI27605 - GTTTATCCAGCATCCAAAAAACTTTGGACTAATTGCATCCTATTTGGAAAGGAAG - UNI4061 - - UNI28761 - 

- UNI32153 - AGTGTTCCTGATTGTGTTTTATATTACTATTTAACCAAGAAAAATGAGAATTATAAGGCCCTCGTGAGAAGGAATTATGGAAAACGC

AGAGGCAGAAATCAG - UNI4061 - - UNI18956 - - UNI32153 - CAGATTGCCCGTCCCTCACAAGAAGAAAAAGTAGAAGAAAAGGAAG

AGGATAAAGCAGAAAAAACAGAGAAAAAGGAAGAAGAAAAGAAGGATGATGAAGAAAAAGATGATAAGGAAGACTCTAA - UNI18956 - - UNI32

153 - AGAAACAACCAAGGAAAAGGACAGAACGGAAGCCACAGCAGAAGAACCTGAAGAAAGAGAGCAGGTCACTCCAAGGGGGCGAAAGACTGCTAAC

AGCCAAGGCCGCCGGAAGGGCCGGGTCACCAGGTCGATGACAAGTGAAGCTGCAGCTGCCAATGCTGCTGCTGCAGCCACTGAGGAGCCCCCGCCACCCC

TGCCGCCACCACCAGAGCCCA - UNI6689 - TTTCTACAGAACCTGTTGAGACTTCAAGATGGACAGAAGAAGAAATGGAAGTTGCTAAAAAAG - 

UNI6689 - GCCTGGTAGAACATGGTCGTAACTGGGCAGCCATTGCTAAAATGGTGGGAACTAAAAGTGAAGCCCAGTGCAAAAACTTCTATTTTAACT

ATAAAAGACGGCATAATCTTGACAACCTTTTGCAGCAACATAAACAGAAA GCTTCACGGAAACCCCGTGAGGAACGAGATGTATCTCAGTGTGAAAGTG

TTGCTTCCACTGTTTCTGCCCAAGAGGATGAAGATATTGAAGCCTCAAATGAGGAGGAAAATCCAGAAGATAGTGAAG GTGCTGAAAATAGTTCTGATA

CAGAAAGTGCTCCCTCTCCTTCACCAGTTGAAGCTGCCAAGTCCAGTGAAGACAGCAGTGAAAATGCTGCTTCTCGAGGAAACACCGAGCCTGTGGCTGA

GCTTGAGGCCACCACTGACCCTGCACCCTGTGCATCTCCCTCTTCAGCAGTTCCAACCACAAAACCAGCAGAAAGGGAAAGCGTGGAGGCCCAGGTGACC

GACAGCGCCAGTGCTGAGACCGCAGAGCCGATGGACGTAGACCATGAGGAGTGCGGTGCCGAGGGCAGTTCTGTTCTTGATCCACCAGCCCCTACCAAAG

CCGACTCCGTGGACCCAGAAATGCAGGTACCAGAAAATACTGCGTCTAAAGGTGAAGGGGATGCCAAGGAAAGAGACTTGGAGAGCACCAGTGAGAAGAC

AGAGGCTAGAGATGAAGACGTGGTAGTGGCTGAACAGATCGAGAGGCCTGAGCCACAGTCAGACGACGACTCCAGTGCCACTTGCAGTGCGGATGAGGGT

GTGGATGGAGAGCCAGAGAGGCAGAG AGTGTTTCCCATGGATGCAAAGCCTTCATTGTTAACTCCTCCTGGATCTATCCTAATCTCATCCCCTATTAAA

CCAAACCCATTGGATCTGCCACAGCTTCAGCATCGAGCTGCTGTTATTCCACCAATG - UNI9235 - GTTTCTTGCACTCCATGTAATATACCAATT

GGAACGCCCGTAAGTGGCTATGCTCTTTACCAACGGCACATTAAGGCCATGCATGAGTCAGCACTCCTGGAGGAGCAGCGGCAGAGGCAAGAACAGGTAG

ACTTGGAATGCAGAAGCTCTACAAGCCCATGCAGCACTTCTAAGAGTCCAAACAGGGAGTGGGAAGGTAGGTAGATGAAGCCATCA
Translation
MSSSGYPPNQGAFSTEQSRYPSHSVQYTFPSTRHQQ - UNI2063 - - UNI3377 - - UNI4769 - - UNI10810 - - UNI14267 - -

 UNI14658 - - UNI17971 - DSAFGSKHEAPSSPLAGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQ - UNI4769 - -

 UNI14658 - - UNI18571 - QQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENR - UNI4983 - - UNI16829 - KKAEEAHKIFE

GLGPKVEL - UNI4983 - PLYNQPSDTKVYHENIKT - UNI27659 - TNQVMRKKLILFFKRRNHARKQR EQKICQRYDQLMEAWEKKVDRIE

NNPRRKAKESKTREYYEKQFPEIRKQREQQERFQR - UNI17360 - RVGQRGAGLSATIARSEHEISEIIDGLSEQE - UNI27605 - NNEKQM

RQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDK - UNI27605 - KFIQHPKNFGLIASYLERK - UNI4061 - 

- UNI28761 - - UNI32153 - SVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQ - UNI4061 - - UNI18956 - - UNI32153 - Q

IARPSQEEKVEEKEEDKAEKTEKKEEEKKDDEEKDDKEDSK - UNI18956 - - UNI32153 - KETTKEKDRTEATAEEPEEREQVTPRGRKTAN

SQGRRKGRVTRSMTSEAAAANAAAAATEEPPPPLPPPPEPI - UNI6689 - ISTEPVETSRWTEEEMEVAKKG - UNI6689 - GLVEHGRNWAA

IAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQK ASRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEG GAENSSDTESAPSPSPVEA

AKSSEDSSENAASRGNTEPVAELEATTDPAPCASPSSAVPTTKPAERESVEAQVTDSASAETAEPMDVDHEECGAEGSSVLDPPAPTKADSVDPEMQVPE

NTASKGEGDAKERDLESTSEKTEARDEDVVVAEQIERPEPQSDDDSSATCSADEGVDGEPERQR RVFPMDAKPSLLTPPGSILISSPIKPNPLDLPQLQ

HRAAVIPPM - UNI9235 - VSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQVDLECRSSTSPCSTSKSPNREWEGR
Transcript ENSMUST00000108708
Sequence
GAGGGGGAGGGAGTGGGGTTGAGGCAAGATGGCGGCTAAGGTGGCGAAGCTGCGGCGGCGGCGGCTGGAGTGAGCGCCCAGCTCGCCGCGCTGCCGAGCG

AGGGCCGGGCGGAGGGCCGCGCGCCGGGGCCGCGCCCCGGTCGTCCGGCCGTGGGGCGCGCCGGCTCTCACTCCGCCAGCTCCCG - UNI468 - - U

NI3377 - GTTGCTTCCTAGAAACATGGTTGTTTGTTGGACTTGATCTCACAGCCCAGTGAGGACGTCTTTACTGATAATGTCAAGTTCAGGTTACCCT

CCCAACCAAGGAGCTTTCAGCACAGAGCAAAGTCGTTATCCTTCACATTCTGTCCAGTATACCTTTCCCAGTACCCGACACCAGCAG - UNI3377 - 

- UNI14267 - - UNI17971 - GAATTTGCAGTTCCTGACTACCGCTCTTCTCATATTGAAGTTAGCCAGGCATCACAGCTTTTACAGCAGCAGCA

GCAGCAGCAGCAGCTTCGAAGACGACCTTCCTTGCTTTCAGAATTTCACCCGGGTTCTGACAG - UNI2063 - - UNI10810 - - UNI14267 

- - UNI14658 - - UNI17971 - GCCTCAAGAAAGGAGAACTGGATATGAACAGTTTCACTCAGGACCCTCACCGGTGGATCATGATTCCTTGGA

GTCCAAGCGCCCACGCCTGGAGCCAGTTTCTGATGCCCATTTCCAGCGTGTTAGTGCTGCGGTTTTACCTTTAGTTCACTCGCTGCCAGAAGGCTTGAGG

TCGTCTGCAGATGCTAAGAAG - UNI4769 - - UNI10810 - - UNI14658 - GATTCAGCATTTGGAAGCAAACATGAAGCTCCATCCTCTC

CTTTGGCTGGGCAACCATGTGGAGATGACCAAAATGCTTCACCTTCAAAGCTTTCAAAGGAGGAGTTAATACAGAGTATGGACCGGGTAGACCGAGAGAT

TGCAAAAGTAGAGCAGCAGATCCTTAAATTGAAAAAGAAACAA - UNI4769 - - UNI14658 - - UNI18571 - CAACAGCTAGAAGAAGAA

GCAGCTAAGCCCCCTGAACCAGAGAAGCCTGTGTCCCCTCCTCCTGTGGAACAAAAACACCGTAGTATTGTCCAAATTATTTATGATGAGAATCGG - U

NI4983 - - UNI16829 - AAAAAAGCAGAAGAAGCTCATAAAATATTTGAAGGTCTTGGCCCAAAAGTTGAACTG - UNI4983 - CCACTCTA

TAACCAGCCATCAGATACCAAGGTGTACCATGAGAACATCAAGAC - UNI27659 - AAACCAGGTGATGAGGAAAAAACTCATTTTATTTTTTAAAA

GAAGAAATCATGCAAGAAAACAAAGG GAACAAAAAATCTGCCAGCGCTATGATCAGCTCATGGAAGCGTGGGAGAAAAAAGTGGACAGAATAGAAAATA

ATCCCCGGAGGAAAGCAAAAGAAAGCAAAACAAGGGAATACTATGAGAAGCAGTTTCCAGAAATTCGAAAACAAAGAGAACAGCAAGAAAGATTTCAGCG

 - UNI17360 - AGTTGGTCAGAGGGGAGCTGGTCTTTCAGCCACCATTGCTAGGAGTGAGCATGAGATTTCTGAAATTATTGATGGTCTTTCTGAAC

AGGAG - UNI27605 - AATAATGAGAAGCAAATGCGTCAGCTTTCTGTGATTCCACCTATGATGTTTGATGCAGAACAAAGAAGGGTCAAATTCATC

AATATGAATGGGCTGATGGAGGATCCAATGAAGGTTTATAAAGACAGACAGTTTATGAATGTTTGGACTGACCATGAAAAGGAGATCTTTAAGGACAA -

 UNI27605 - GTTTATCCAGCATCCAAAAAACTTTGGACTAATTGCATCCTATTTGGAAAGGAAG - UNI4061 - - UNI28761 - - UNI32

153 - AGTGTTCCTGATTGTGTTTTATATTACTATTTAACCAAGAAAAATGAGAATTATAAGGCCCTCGTGAGAAGGAATTATGGAAAACGCAGAGGCA

GAAATCAG - UNI4061 - - UNI18956 - - UNI32153 - CAGATTGCCCGTCCCTCACAAGAAGAAAAAGTAGAAGAAAAGGAAGAGGATAA

AGCAGAAAAAACAGAGAAAAAGGAAGAAGAAAAGAAGGATGATGAAGAAAAAGATGATAAGGAAGACTCTAA - UNI18956 - - UNI32153 - A

GAAACAACCAAGGAAAAGGACAGAACGGAAGCCACAGCAGAAGAACCTGAAGAAAGAGAGCAGGTCACTCCAAGGGGGCGAAAGACTGCTAACAGCCAAG

GCCGCCGGAAGGGCCGGGTCACCAGGTCGATGACAAGTGAAGCTGCAGCTGCCAATGCTGCTGCTGCAGCCACTGAGGAGCCCCCGCCACCCCTGCCGCC

ACCACCAGAGCCCA - UNI6689 - TTTCTACAGAACCTGTTGAGACTTCAAGATGGACAGAAGAAGAAATGGAAGTTGCTAAAAAAG - UNI6689

 - GCCTGGTAGAACATGGTCGTAACTGGGCAGCCATTGCTAAAATGGTGGGAACTAAAAGTGAAGCCCAGTGCAAAAACTTCTATTTTAACTATAAAAG

ACGGCATAATCTTGACAACCTTTTGCAGCAACATAAACAGAAAGTGAGTAGAGCAGTAGTG GCTTCACGGAAACCCCGTGAGGAACGAGATGTATCTCA

GTGTGAAAGTGTTGCTTCCACTGTTTCTGCCCAAGAGGATGAAGATATTGAAGCCTCAAATGAGGAGGAAAATCCAGAAGATAGTGAAG TTGAAGCTGC

CAAGTCCAGTGAAGACAGCAGTGAAAATGCTGCTTCTCGAGGAAACACCGAGCCTGTGGCTGAGCTTGAGGCCACCACTGACCCTGCACCCTGTGCATCT

CCCTCTTCAGCAGTTCCAACCACAAAACCAGCAGAAAGGGAAAGCGTGGAGGCCCAGGTGACCGACAGCGCCAGTGCTGAGACCGCAGAGCCGATGGACG

TAGACCATGAGGAGTGCGGTGCCGAGGGCAGTTCTGTTCTTGATCCACCAGCCCCTACCAAAGCCGACTCCGTGGACCCAGAAATGCAGGTACCAGAAAA

TACTGCGTCTAAAGGTGAAGGGGATGCCAAGGAAAGAGACTTGGAGAGCACCAGTGAGAAGACAGAGGCTAGAGATGAAGACGTGGTAGTGGCTGAACAG

ATCGAGAGGCCTGAGCCACAGTCAGACGACGACTCCAGTGCCACTTGCAGTGCGGATGAGGGTGTGGATGGAGAGCCAGAGAGGCAGAG AGTGTTTCCC

ATGGATGCAAAGCCTTCATTGTTAACTCCTCCTGGATCTATCCTAATCTCATCCCCTATTAAACCAAACCCATTGGATCTGCCACAGCTTCAGCATCGAG

CTGCTGTTATTCCACCAATG - UNI9235 - GTTTCTTGCACTCCATGTAATATACCAATTGGAACGCCCGTAAGTGGCTATGCTCTTTACCAACGGC

ACATTAAGGCCATGCATGAGTCAGCACTCCTGGAGGAGCAGCGGCAGAGGCAAGAACAGGTAGACTTGGAATGCAGAAGCTCTACAAGCCCATGCAGCAC

TTCTAAGAGTCCAAACAGGGAGTGGGAAG - UNI9235 - GAAAATCAGTCGCCTATATGCCTTATGCTGAGGTCAAACGTGCTCTAGAGCAGGAAGC

ACACATGCACAGTACCGCAGCAAGGTCAGCCTCACCGTGCAGGCTCTCTCCAAGAGAAGTCAGTAAAGCCGCTTCCCAGCCTGATATGAGTGCAGCCCGC

TATAGTGTCCCTCCAG TCCTCCAACCTGCTCCGCATCAAGTGATAACTAACCTTCCTGAAGGGGTTCGGCTTCCAACAACACGACCAACCAGGCCACCA

CCTCCCCTCATCCCATCATCTAAAACCACAGTGGCATCAGAAAAACCATCCTTTATAATGGGAGGGTCTATCTCACAG - UNI27108 - GGAACTCC

TGGCACTTACTTGTCTTCTCATAATCAGGCTTATCCACAAGAAGCCCCTAAGCCCTCCGTGGGGTCTATCTCTCTGGGATTGCCCCGGCAGCAGGAGTCT

ACCAAAGCAG - UNI26134 - CTCCTTTGACCTACATCAAGCAGGAAGAATTTTCTCCGAGAAGCCAAAACTCACAACCTGAGGGTTTATTGGTCAG

AGCGCAGCATGAAGGTGTGGTCAGAG - UNI20028 - GCACTGCAGGGGCTGTCCAAGAAGGAAGTATAACTCGGGGAACTCCAGCCAGCAAAATCT

CAGTGGAGACCATTTCATCGTTGCGGGGCTCTATTACCCAG - UNI20330 - GGGACCCCAGCTCTGCCCCAGGCTGGAATACCAACAGAGGCTTTG

GTGAAGGGACCTGTCTCCAGGATGCCTATTGAAGAAAGCAGTCCTGAGAAGGTCAGAGAGGAAGCTGCATCCAAGGGCCATGTTATCTATGAAGGCAAAA

GTGGACATATCTTATCATATGATA - UNI12079 - - UNI20330 - ATATTAAGAATGCCCGAGAAGGGACTCGGAGTCCAAGAACAGCTCATGA

AATGAGTTTAAAAAGAAGCTATGAGGCAGTGGAAGGAAGTATAAAGCAAGGCATGTCGATGAGGGAGTCTCCTGTGTCAGCACCTTTAGAGG - UNI22

523 - GTCTGATATGCCGAGCATTACCCAGGGGGAGCCCTCATTCTGACCTCAAAGAGAGGACTGTGCTGTCTGGTTCCATAATGCAGG GCACACCAA

GAGCCACAGCGGAAAGCTTTGAGGACGGCCTTAAATACCCCAAACAGATAAAAAGGGAGAGCCCTCCCATCCGAGCATTTGAAGGTGCCATTACCAAAGG

AAAACCATACGATGGTATCACCACCATCAAAGAAATGGGGCGCTCCATCCATGAAATCCCACGGCAAGATATTCTAACTCAGGAAAGCCGGAAAACTCCA

GAAGTGGTCCAGAGCACGAGGCCAATAATTGAGGGTTCCATTTCCCAG - UNI7679 - GGCACACCAATAAAATTTGACAACAACTCAGGTCAATCA

GCTATCAAACACAATGTGAAGTCCTTAATCACAGGGCCTAGCAAACTACCCCGTGGAATGCTGGAAATTGTACCAGAGAACATAAAAGTAGTAGAACGGG

GAAAATATGAGGATGTGAAAGCAGGCGAGCCAGTGCGAGCCCGGCACACGTCAGTGGTGAGCTCTGGCCCCTCCGTTCTCAGGTCTACACTTCACGAAGC

TCCCAAAGCACAGCTGAGCCCGGGACTCTATGATGACAGCAGCGCTCGCAGGACTCCTGTGAGCTACCAGAACACCATATCCAGAGGCTCCCCCATGATG

AACAGAACTTCTGATG TTTCTTCCAGCAAGTCTGCCAGTCATGAAAGGAAATCAACTCTGACCCCAACCCAAAGAGAAAGTATACCAGCCAAGTCTCCA

GTGCCCGGGGTGGATCCCGTCGTGAGTCACAGCCCATTTGATCCTCATCACAGGAGTAGCGCTGCAGGAGAGGTTTATCGGAGCCACCTACCCACGCACT

TGGATCCAGCTATGCCCTTTCACAGGGCTTTGGATCCTG - UNI290 - - UNI29379 - CAGCTGCTGCTTACCTGTTACAGAGACAGCTTTCAC

CAACCCCAGGATACCCAAGTCAGTACCAGCTCTATGCAATGGAGAATACAAGGCAGACAATCCTCAACGATTACATTACCTCACAGCAGATGCAGGTGAA

TCTGCGCCCTGATGTCACCAGGGGACTGTCCCCACGAGAGCAGCCACTGGGGCTCCCTTACCCAGCTACAAGAG GAATCATTGACCTGACCAATATGCC

TCCAACAATCTTAGTGCCTCATGCAGGGGGAACGAGCACCCCTCCCATGGACAGGATCACGTATATTCCTGGTACACAGGTTACTTTCCCTCCCAGGCCA

TATAACGCTGCTTCTCTGTCTCCAG GACACCCAACACACCTTGCAGCAGCTGCAAGTGCTGAGAGGGAACGAGAGCGGGAAAGGGAGAAGGAGCGCGAA

CGTGAGCGCGAGCGTGAGCGTGAACGTGAACGCGAAAGGATCGCTGCTGCTCCCGCTGACCTCTACCTACGACCAG GTTCAGAACAGCCAGGCCGTCCT

GGCAGCCACGGATATGTTCGCTCCCCTTCCCCTTCAGTAAGAACTCAGGAGACCATCCTGCAACAGAGACCCAGTGTTTTCCAGGGCACCAATGGAACCA

GTGTAATCACACCTTTGGACCCAACTGCTCAGCTACGCATCAT GCCACTGCCTTCTGGGGGCCCTTCCATAAGTCAAGGCCTGCCAGCCTCCCGTTACA

ACACTGCTGCGGATGCCCTGGCTGCTCTTGTGGATGCTGCAGCTTCTGCACCCCAGATGGATGTTTCCAAAACAAAAGAGAGTAAGCATGAAGCTGCCAG

GTTAGAAGAAAATTTGAGAAGCAGGTCAGCAGCAGTTAGTGAACAGCAGCAGCTAGAGCAGAAAAACCTGGAGGTGGAGAAGAGATCTGTTCAGTGTGTG

TGCACTTCTTCAGCCCTTCCAAGTGGCAAGGCCCAGCCTCATGCCTCAGTAGTGTATTCTGAGGCTGGGAAAGATAAAGGGCCTCCTCCAAAATCCAGAT

ATGAGGAAGAGCTAAGGACCCGAGGGAAGACTACCATTACTGCAGCTAACTTCATAGACGTGATCATCACCCGGCAAATTGCCTCGGACAAGGATGCGAG

GGAACGTGGCTCTCAAAGTTCAGACTCTTCTAGTAGCT - UNI2493 - TGTCTTCTCACAGGTATGAAACGGCTAGTGATGCCATTGAGGTGATAAG

TCCCGCCAGCTCACCTGCACCACCCCAGGAAAAGCCACAGGCCTATCAGCCAGACATGGTTAAGGCAAATCAAGCAGAAA ATGAGTCCACTCGACAGTA

TGAAGGTCCACTGCATCATTATCGGTCCCAGCAGGAATCACCATCTCCACAGCAACAGCCACCACTGCCCCCATCTTCCCAGTCAGAGGGAATGGGACAG

GTGCCCAGGACCCATCGACTGATCACACTTGCTGACCACATCTGT CAAATTATCACACAAGATTTTGCTAGAAATCAAGTTCCCTCGCAGCCTTCTACT

TCTACATTCCAAACTTCACCATCTGCTTTGTCATCCACACCTGTAAGAACTAAAACCTCAAGCCGCTACAGCCCAGAATCACAGTCTCAGACTGTCTTGC

ATCCCAGACCAGGTCCTAGAGTCTCTCCAGAAAATCTTGTGGATAAATCCCGGGGAAG CAGGCCTGGAAAATCTCCAGAGAGGAGTCATATCCCATCAG

AGCCCTATGAGCCCATCTCCCCACCCCAAGGCCCTGCTGTGCATGAGAAGCAGGACAGCATGTTGCTCTTGTCACAGAGGGGAGTGGACCCTGCTGAGCA

AAG - UNI5550 - GAGTGATTCTCGATCACCAGGAAGTATAAGCTACTTGCCTTCATTCTTCACCAAGCTTGAAAGCACATCACCCATGGTTAAATC

AAAGAAACAGGAAATTTTTCGTAAGTTGAACTCTTCTGGTGGAGGTGACTCTGATATGG - UNI5550 - CAGCTGCTCAGCCAGGAACAGAGATCTT

CAATCTGCCAGCAGTTACCACATCAG GTGCAGTGAGCTCAAGAAGCCATTCTTTTGCTGATCCCGCCAGTAACCTTGGTCTAGAAGACATCATCAGAAA

GGCTCTCATGGGAAGTTTTGATGATAAAGTTGAAGATCATGGTGTTGTCATGTCCCATCCTGTGGGCATTATGCCTGGTAGTGCCAGCACCTCAGTGGTG

ACGAGCAGCGAGGCACGGAGAGATGAAGGGGAGCCATCACCTCATGCAG GAGTATGCAAACCAAAGCTGATCAACAAATCAAACAGCAGGAAGTCTAAA

TCTCCTATTCCTGGGCAAAGCTATTTAGGAACTGAAAGGCCTTCTTCTGTCTCCTCTGTGCATTCAGAAGGTGATTACCACAGGCAGACACCAGGATGGG

CATGGGAAGATCGGCCCTCTTCAACAG - UNI160 - - UNI27798 - GTTCTACTCAGTTCCCTTACAACCCTCTGACCATACGGATGCTCAGCA

GTACACCACCTACACAGATCGCATGCGCCCCATCTGCCATCACCCAAGCAGCTCCACATCAACAGAACCGCATCTGGGAGAGGGAGCCTGCCCCGCTCCT

CTCAGCGCAGTATGAGACACTGTCTGATAGTGACGACTGAGCTGTGCGTGGGAGAGCGCTCTGGCTTTGGTTTTTATTGAAGATTTAAAAAAAAAAAAAG

AAAATTATTCTGCCCTCCCATGATTTGTGCCCAGAGACTTCTCAGGAGAGCCAGGGCCATGGATGAGGAAGAAATGATGGAAATTCATTTGGAAAATCAA

ATGGGAAAAAACAAACAAAAAAACTGCCTCTAATACAGGCACTTCAATGGATTATAACAGTGGCGGGTTGAAGTGTAGAGTTTTTTTAAAGTGGACAATT

CTTGTTCTTACATCTGTTTGTAAAGAAAACCATGATGTCTTTAAATCAATCTTCTGTAAATAGATGACTTTTTTGCAGTGTATCCCCTTGCTGTAGTATC

TGGTGTACTTAAATTTAAATCAGCGAATCAACTGGGGAGAATTTTTAAAATTCTTTGTGTATCTTTTTAACCCCAGCCTCTAAACCTCACACAGCCCAGT

TCCACAGTGCTGGCTGTCATGGGCATTGTACTTTTGTTTCCTCTAAATTCAGCTTTCCCAGTGATGTTTAAATCTTGTGGAAATATTTAGGTTTTTAACA

CATACCCTGTCATAAAGCCTGTATGAGGTCAGAAGACAGGAGCAACACAACTGTCATATTGTGAGTTCCAGTGCAGGCTTGGCTTTCATTGGTAGCACTG

AAAAAAATTACTGCATGGGTATGTTATAGTTCAGTTTTAAAGTTTAAAGGCTTTTTTGAGGCATACCTCAATGTTTATGCACACTGGTAATTTAACCACG

CCCCCTAAGTATTCTGCATTTGATGCAGCCCAACAAAGCTTCTTTCTGTTCTGAAATAAATTTTGACTATCCTGTCCATAGCTACAGTACATCATTTGTG

ACGTAAAGAGTCTTCGTTTCTCAGGTTTCAAACAATTAGTATACATGCTTTTCTTTAGATACAGAATTGGCGGAGTTAAAAAGAGAACACTGTATAGAAC

TTTCTGTCTTCCAGGCTTGTTTTTATGCTGCATCGTGAACTGACCGTTGAGCACAGTCCTCTGCATCAGTGCCCATTCTCTGCTCCTAGGGAACAGATTC

TTAAGGTGCAAGTAATTTAAAGACTGAATTTTAAACTAATTATGGCACTGTAGGATCACCTTTATTCATTAAGAATTGCTTGCTGTGATTCAG
Translation
 - UNI468 - - UNI3377 -  - UNI3377 - - UNI14267 - - UNI17971 -  - UNI2063 - - UNI10810 - - UNI14267 

- - UNI14658 - - UNI17971 -  - UNI4769 - - UNI10810 - - UNI14658 -  - UNI4769 - - UNI14658 - - UNI18

571 -  - UNI4983 - - UNI16829 -  - UNI4983 -  - UNI27659 -   - UNI17360 -  - UNI27605 - MRQLSVIPPMMF

DAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDK - UNI27605 - KFIQHPKNFGLIASYLERK - UNI4061 - - UNI28761 

- - UNI32153 - SVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQ - UNI4061 - - UNI18956 - - UNI32153 - QIARPSQEEKVE

EKEEDKAEKTEKKEEEKKDDEEKDDKEDSK - UNI18956 - - UNI32153 - KETTKEKDRTEATAEEPEEREQVTPRGRKTANSQGRRKGRVTR

SMTSEAAAANAAAAATEEPPPPLPPPPEPI - UNI6689 - ISTEPVETSRWTEEEMEVAKKG - UNI6689 - GLVEHGRNWAAIAKMVGTKSEA

QCKNFYFNYKRRHNLDNLLQQHKQKVSRAVV ASRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEV VEAAKSSEDSSENAASRGNTEPVA

ELEATTDPAPCASPSSAVPTTKPAERESVEAQVTDSASAETAEPMDVDHEECGAEGSSVLDPPAPTKADSVDPEMQVPENTASKGEGDAKERDLESTSEK

TEARDEDVVVAEQIERPEPQSDDDSSATCSADEGVDGEPERQR RVFPMDAKPSLLTPPGSILISSPIKPNPLDLPQLQHRAAVIPPM - UNI9235 -

 VSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQVDLECRSSTSPCSTSKSPNREWEG - UNI9235 - GKSVAYMPYAEVKRALEQEA

HMHSTAARSASPCRLSPREVSKAASQPDMSAARYSVPPV VLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQ - UNI

27108 - GTPGTYLSSHNQAYPQEAPKPSVGSISLGLPRQQESTKAA - UNI26134 - APLTYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRG - 

UNI20028 - GTAGAVQEGSITRGTPASKISVETISSLRGSITQ - UNI20330 - GTPALPQAGIPTEALVKGPVSRMPIEESSPEKVREEAASKG

HVIYEGKSGHILSYDN - UNI12079 - - UNI20330 - NIKNAREGTRSPRTAHEMSLKRSYEAVEGSIKQGMSMRESPVSAPLEG - UNI225

23 - GLICRALPRGSPHSDLKERTVLSGSIMQG GTPRATAESFEDGLKYPKQIKRESPPIRAFEGAIT - UNI7679 -   - UNI290 - - UN

I29379 -      - UNI2493 -     - UNI5550 -  - UNI5550 -    - UNI160 - - UNI27798 - 
Transcript ENSMUST00000101069
Sequence
GAGGGGGAGGGAGTGGGGTTGAGGCAAGATGGCGGCTAAGGTGGCGAAGCTGCGGCGGCGGCGGCTGGAGTGAGCGCCCAGCTCGCCGCGCTGCCGAGCG

AGGGCCGGGCGGAGGGCCGCGCGCCGGGGCCGCGCCCCGGTCGTCCGGCCGTGGGGCGCGCCGGCTCTCACTCCGCCAGCTCCCG - UNI468 - - U

NI3377 - GTTGCTTCCTAGAAACATGGTTGTTTGTTGGACTTGATCTCACAGCCCAGTGAGGACGTCTTTACTGATAATGTCAAGTTCAGGTTACCCT

CCCAACCAAGGAGCTTTCAGCACAGAGCAAAGTCGTTATCCTTCACATTCTGTCCAGTATACCTTTCCCAGTACCCGACACCAGCAG - UNI3377 - 

- UNI14267 - - UNI17971 - GAATTTGCAGTTCCTGACTACCGCTCTTCTCATATTGAAGTTAGCCAGGCATCACAGCTTTTACAGCAGCAGCA

GCAGCAGCAGCAGCTTCGAAGACGACCTTCCTTGCTTTCAGAATTTCACCCGGGTTCTGACAG - UNI2063 - - UNI10810 - - UNI14267 

- - UNI14658 - - UNI17971 - GCCTCAAGAAAGGAGAACTGGATATGAACAGTTTCACTCAGGACCCTCACCGGTGGATCATGATTCCTTGGA

GTCCAAGCGCCCACGCCTGGAGCCAGTTTCTGATGCCCATTTCCAGCGTGTTAGTGCTGCGGTTTTACCTTTAGTTCACTCGCTGCCAGAAGGCTTGAGG

TCGTCTGCAGATGCTAAGAAG - UNI4769 - - UNI10810 - - UNI14658 - GATTCAGCATTTGGAAGCAAACATGAAGCTCCATCCTCTC

CTTTGGCTGGGCAACCATGTGGAGATGACCAAAATGCTTCACCTTCAAAGCTTTCAAAGGAGGAGTTAATACAGAGTATGGACCGGGTAGACCGAGAGAT

TGCAAAAGTAGAGCAGCAGATCCTTAAATTGAAAAAGAAACAA - UNI4769 - - UNI14658 - - UNI18571 - CAACAGCTAGAAGAAGAA

GCAGCTAAGCCCCCTGAACCAGAGAAGCCTGTGTCCCCTCCTCCTGTGGAACAAAAACACCGTAGTATTGTCCAAATTATTTATGATGAGAATCGG - U

NI4983 - - UNI16829 - AAAAAAGCAGAAGAAGCTCATAAAATATTTGAAGGTCTTGGCCCAAAAGTTGAACTG - UNI4983 - CCACTCTA

TAACCAGCCATCAGATACCAAGGTGTACCATGAGAACATCAAGAC - UNI27659 - AAACCAGGTGATGAGGAAAAAACTCATTTTATTTTTTAAAA

GAAGAAATCATGCAAGAAAACAAAGG GAACAAAAAATCTGCCAGCGCTATGATCAGCTCATGGAAGCGTGGGAGAAAAAAGTGGACAGAATAGAAAATA

ATCCCCGGAGGAAAGCAAAAGAAAGCAAAACAAGGGAATACTATGAGAAGCAGTTTCCAGAAATTCGAAAACAAAGAGAACAGCAAGAAAGATTTCAGCG

 - UNI17360 - AGTTGGTCAGAGGGGAGCTGGTCTTTCAGCCACCATTGCTAGGAGTGAGCATGAGATTTCTGAAATTATTGATGGTCTTTCTGAAC

AGGAG - UNI27605 - AATAATGAGAAGCAAATGCGTCAGCTTTCTGTGATTCCACCTATGATGTTTGATGCAGAACAAAGAAGGGTCAAATTCATC

AATATGAATGGGCTGATGGAGGATCCAATGAAGGTTTATAAAGACAGACAGTTTATGAATGTTTGGACTGACCATGAAAAGGAGATCTTTAAGGACAA -

 UNI27605 - GTTTATCCAGCATCCAAAAAACTTTGGACTAATTGCATCCTATTTGGAAAGGAAG - UNI4061 - - UNI28761 - - UNI32

153 - AGTGTTCCTGATTGTGTTTTATATTACTATTTAACCAAGAAAAATGAGAATTATAAGGCCCTCGTGAGAAGGAATTATGGAAAACGCAGAGGCA

GAAATCAG - UNI4061 - - UNI18956 - - UNI32153 - CAGATTGCCCGTCCCTCACAAGAAGAAAAAGTAGAAGAAAAGGAAGAGGATAA

AGCAGAAAAAACAGAGAAAAAGGAAGAAGAAAAGAAGGATGATGAAGAAAAAGATGATAAGGAAGACTCTAA - UNI18956 - - UNI32153 - A

GAAACAACCAAGGAAAAGGACAGAACGGAAGCCACAGCAGAAGAACCTGAAGAAAGAGAGCAGGTCACTCCAAGGGGGCGAAAGACTGCTAACAGCCAAG

GCCGCCGGAAGGGCCGGGTCACCAGGTCGATGACAAGTGAAGCTGCAGCTGCCAATGCTGCTGCTGCAGCCACTGAGGAGCCCCCGCCACCCCTGCCGCC

ACCACCAGAGCCCA - UNI6689 - TTTCTACAGAACCTGTTGAGACTTCAAGATGGACAGAAGAAGAAATGGAAGTTGCTAAAAAAG - UNI6689

 - GCCTGGTAGAACATGGTCGTAACTGGGCAGCCATTGCTAAAATGGTGGGAACTAAAAGTGAAGCCCAGTGCAAAAACTTCTATTTTAACTATAAAAG

ACGGCATAATCTTGACAACCTTTTGCAGCAACATAAACAGAAAGTGAGTAGAGCAGTAGTG GCTTCACGGAAACCCCGTGAGGAACGAGATGTATCTCA

GTGTGAAAGTGTTGCTTCCACTGTTTCTGCCCAAGAGGATGAAGATATTGAAGCCTCAAATGAGGAGGAAAATCCAGAAGATAGTGAAG GTGCTGAAAA

TAGTTCTGATACAGAAAGTGCTCCCTCTCCTTCACCAGTTGAAGCTGCCAAGTCCAGTGAAGACAGCAGTGAAAATGCTGCTTCTCGAGGAAACACCGAG

CCTGTGGCTGAGCTTGAGGCCACCACTGACCCTGCACCCTGTGCATCTCCCTCTTCAGCAGTTCCAACCACAAAACCAGCAGAAAGGGAAAGCGTGGAGG

CCCAGGTGACCGACAGCGCCAGTGCTGAGACCGCAGAGCCGATGGACGTAGACCATGAGGAGTGCGGTGCCGAGGGCAGTTCTGTTCTTGATCCACCAGC

CCCTACCAAAGCCGACTCCGTGGACCCAGAAATGCAGGTACCAGAAAATACTGCGTCTAAAGGTGAAGGGGATGCCAAGGAAAGAGACTTGGAGAGCACC

AGTGAGAAGACAGAGGCTAGAGATGAAGACGTGGTAGTGGCTGAACAGATCGAGAGGCCTGAGCCACAGTCAGACGACGACTCCAGTGCCACTTGCAGTG

CGGATGAGGGTGTGGATGGAGAGCCAGAGAGGCAGAG AGTGTTTCCCATGGATGCAAAGCCTTCATTGTTAACTCCTCCTGGATCTATCCTAATCTCAT

CCCCTATTAAACCAAACCCATTGGATCTGCCACAGCTTCAGCATCGAGCTGCTGTTATTCCACCAATG - UNI9235 - GTTTCTTGCACTCCATGTA

ATATACCAATTGGAACGCCCGTAAGTGGCTATGCTCTTTACCAACGGCACATTAAGGCCATGCATGAGTCAGCACTCCTGGAGGAGCAGCGGCAGAGGCA

AGAACAGGTAGACTTGGAATGCAGAAGCTCTACAAGCCCATGCAGCACTTCTAAGAGTCCAAACAGGGAGTGGGAAG - UNI9235 - TCCTCCAACC

TGCTCCGCATCAAGTGATAACTAACCTTCCTGAAGGGGTTCGGCTTCCAACAACACGACCAACCAGGCCACCACCTCCCCTCATCCCATCATCTAAAACC

ACAGTGGCATCAGAAAAACCATCCTTTATAATGGGAGGGTCTATCTCACAG - UNI27108 - GGAACTCCTGGCACTTACTTGTCTTCTCATAATCA

GGCTTATCCACAAGAAGCCCCTAAGCCCTCCGTGGGGTCTATCTCTCTGGGATTGCCCCGGCAGCAGGAGTCTACCAAAGCAG - UNI26134 - CTC

CTTTGACCTACATCAAGCAGGAAGAATTTTCTCCGAGAAGCCAAAACTCACAACCTGAGGGTTTATTGGTCAGAGCGCAGCATGAAGGTGTGGTCAGAG 

- UNI20028 - GCACTGCAGGGGCTGTCCAAGAAGGAAGTATAACTCGGGGAACTCCAGCCAGCAAAATCTCAGTGGAGACCATTTCATCGTTGCGGG

GCTCTATTACCCAG - UNI20330 - GGGACCCCAGCTCTGCCCCAGGCTGGAATACCAACAGAGGCTTTGGTGAAGGGACCTGTCTCCAGGATGCCT

ATTGAAGAAAGCAGTCCTGAGAAGGTCAGAGAGGAAGCTGCATCCAAGGGCCATGTTATCTATGAAGGCAAAAGTGGACATATCTTATCATATGATA - 

UNI12079 - - UNI20330 - - UNI22523 - GTCTGATATGCCGAGCATTACCCAGGGGGAGCCCTCATTCTGACCTCAAAGAGAGGACTGTGC

TGTCTGGTTCCATAATGCAGG GCACACCAAGAGCCACAGCGGAAAGCTTTGAGGACGGCCTTAAATACCCCAAACAGATAAAAAGGGAGAGCCCTCCCA

TCCGAGCATTTGAAGGTGCCATTACCAAAGGAAAACCATACGATGGTATCACCACCATCAAAGAAATGGGGCGCTCCATCCATGAAATCCCACGGCAAGA

TATTCTAACTCAGGAAAGCCGGAAAACTCCAGAAGTGGTCCAGAGCACGAGGCCAATAATTGAGGGTTCCATTTCCCAG - UNI7679 - GGCACACC

AATAAAATTTGACAACAACTCAGGTCAATCAGCTATCAAACACAATGTGAAGTCCTTAATCACAGGGCCTAGCAAACTACCCCGTGGAATGCTGGAAATT

GTACCAGAGAACATAAAAGTAGTAGAACGGGGAAAATATGAGGATGTGAAAGCAGGCGAGCCAGTGCGAGCCCGGCACACGTCAGTGGTGAGCTCTGGCC

CCTCCGTTCTCAGGTCTACACTTCACGAAGCTCCCAAAGCACAGCTGAGCCCGGGACTCTATGATGACAGCAGCGCTCGCAGGACTCCTGTGAGCTACCA

GAACACCATATCCAGAGGCTCCCCCATGATGAACAGAACTTCTGATG TTTCTTCCAGCAAGTCTGCCAGTCATGAAAGGAAATCAACTCTGACCCCAAC

CCAAAGAGAAAGTATACCAGCCAAGTCTCCAGTGCCCGGGGTGGATCCCGTCGTGAGTCACAGCCCATTTGATCCTCATCACAGGAGTAGCGCTGCAGGA

GAGGTTTATCGGAGCCACCTACCCACGCACTTGGATCCAGCTATGCCCTTTCACAGGGCTTTGGATCCTG - UNI290 - - UNI29379 - CAGCT

GCTGCTTACCTGTTACAGAGACAGCTTTCACCAACCCCAGGATACCCAAGTCAGTACCAGCTCTATGCAATGGAGAATACAAGGCAGACAATCCTCAACG

ATTACATTACCTCACAGCAGATGCAGGTGAATCTGCGCCCTGATGTCACCAGGGGACTGTCCCCACGAGAGCAGCCACTGGGGCTCCCTTACCCAGCTAC

AAGAG GAATCATTGACCTGACCAATATGCCTCCAACAATCTTAGTGCCTCATGCAGGGGGAACGAGCACCCCTCCCATGGACAGGATCACGTATATTCC

TGGTACACAGGTTACTTTCCCTCCCAGGCCATATAACGCTGCTTCTCTGTCTCCAG GACACCCAACACACCTTGCAGCAGCTGCAAGTGCTGAGAGGGA

ACGAGAGCGGGAAAGGGAGAAGGAGCGCGAACGTGAGCGCGAGCGTGAGCGTGAACGTGAACGCGAAAGGATCGCTGCTGCTCCCGCTGACCTCTACCTA

CGACCAG GTTCAGAACAGCCAGGCCGTCCTGGCAGCCACGGATATGTTCGCTCCCCTTCCCCTTCAGTAAGAACTCAGGAGACCATCCTGCAACAGAGA

CCCAGTGTTTTCCAGGGCACCAATGGAACCAGTGTAATCACACCTTTGGACCCAACTGCTCAGCTACGCATCAT GCCACTGCCTTCTGGGGGCCCTTCC

ATAAGTCAAGGCCTGCCAGCCTCCCGTTACAACACTGCTGCGGATGCCCTGGCTGCTCTTGTGGATGCTGCAGCTTCTGCACCCCAGATGGATGTTTCCA

AAACAAAAGAGAGTAAGCATGAAGCTGCCAGGTTAGAAGAAAATTTGAGAAGCAGGTCAGCAGCAGTTAGTGAACAGCAGCAGCTAGAGCAGAAAAACCT

GGAGGTGGAGAAGAGATCTGTTCAGTGTGTGTGCACTTCTTCAGCCCTTCCAAGTGGCAAGGCCCAGCCTCATGCCTCAGTAGTGTATTCTGAGGCTGGG

AAAGATAAAGGGCCTCCTCCAAAATCCAGATATGAGGAAGAGCTAAGGACCCGAGGGAAGACTACCATTACTGCAGCTAACTTCATAGACGTGATCATCA

CCCGGCAAATTGCCTCGGACAAGGATGCGAGGGAACGTGGCTCTCAAAGTTCAGACTCTTCTAGTAGCT - UNI2493 - TGTCTTCTCACAGGTATG

AAACGGCTAGTGATGCCATTGAGGTGATAAGTCCCGCCAGCTCACCTGCACCACCCCAGGAAAAGCCACAGGCCTATCAGCCAGACATGGTTAAGGCAAA

TCAAGCAGAAA ATGAGTCCACTCGACAGTATGAAGGTCCACTGCATCATTATCGGTCCCAGCAGGAATCACCATCTCCACAGCAACAGCCACCACTGCC

CCCATCTTCCCAGTCAGAGGGAATGGGACAGGTGCCCAGGACCCATCGACTGATCACACTTGCTGACCACATCTGT CAAATTATCACACAAGATTTTGC

TAGAAATCAAGTTCCCTCGCAGCCTTCTACTTCTACATTCCAAACTTCACCATCTGCTTTGTCATCCACACCTGTAAGAACTAAAACCTCAAGCCGCTAC

AGCCCAGAATCACAGTCTCAGACTGTCTTGCATCCCAGACCAGGTCCTAGAGTCTCTCCAGAAAATCTTGTGGATAAATCCCGGGGAAG GCCTGGAAAA

TCTCCAGAGAGGAGTCATATCCCATCAGAGCCCTATGAGCCCATCTCCCCACCCCAAGGCCCTGCTGTGCATGAGAAGCAGGACAGCATGTTGCTCTTGT

CACAGAGGGGAGTGGACCCTGCTGAGCAAAG - UNI5550 - GAGTGATTCTCGATCACCAGGAAGTATAAGCTACTTGCCTTCATTCTTCACCAAGC

TTGAAAGCACATCACCCATGGTTAAATCAAAGAAACAGGAAATTTTTCGTAAGTTGAACTCTTCTGGTGGAGGTGACTCTGATATGG - UNI5550 - 

CAGCTGCTCAGCCAGGAACAGAGATCTTCAATCTGCCAGCAGTTACCACATCAG GTGCAGTGAGCTCAAGAAGCCATTCTTTTGCTGATCCCGCCAGTA

ACCTTGGTCTAGAAGACATCATCAGAAAGGCTCTCATGGGAAGTTTTGATGATAAAGTTGAAGATCATGGTGTTGTCATGTCCCATCCTGTGGGCATTAT

GCCTGGTAGTGCCAGCACCTCAGTGGTGACGAGCAGCGAGGCACGGAGAGATGAAGGGGAGCCATCACCTCATGCAG GAGTATGCAAACCAAAGCTGAT

CAACAAATCAAACAGCAGGAAGTCTAAATCTCCTATTCCTGGGCAAAGCTATTTAGGAACTGAAAGGCCTTCTTCTGTCTCCTCTGTGCATTCAGAAGGT

GATTACCACAGGCAGACACCAGGATGGGCATGGGAAGATCGGCCCTCTTCAACAG - UNI160 - - UNI27798 - GTTCTACTCAGTTCCCTTAC

AACCCTCTGACCATACGGATGCTCAGCAGTACACCACCTACACAGATCGCATGCGCCCCATCTGCCATCACCCAAGCAGCTCCACATCAACAGAACCGCA

TCTGGGAGAGGGAGCCTGCCCCGCTCCTCTCAGCGCAGTATGAGACACTGTCTGATAGTGACGACTGAGCTGTGCGTGGGAGAGCGCTCTGGCTTTGGTT

TTTATTGAAGATTTAAAAAAAAAAAAAGAAAATTATTCTGCCCTCCCATGATTTGTGCCCAGAGACTTCTCAGGAGAGCCAGGGCCATGGATGAGGAAGA

AATGATGGAAATTCATTTGGAAAATCAAATGGGAAAAAACAAACAAAAAAACTGCCTCTAATACAGGCACTTCAATGGATTATAACAGTGGCGGGTTGAA

GTGTAGAGTTTTTTTAAAGTGGACAATTCTTGTTCTTACATCTGTTTGTAAAGAAAACCATGATGTCTTTAAATCAATCTTCTGTAAATAGATGACTTTT

TTGCAGTGTATCCCCTTGCTGTAGTATCTGGTGTACTTAAATTTAAATCAGCGAATCAACTGGGGAGAATTTTTAAAATTCTTTGTGTATCTTTTTAACC

CCAGCCTCTAAACCTCACACAGCCCAGTTCCACAGTGCTGGCTGTCATGGGCATTGTACTTTTGTTTCCTCTAAATTCAGCTTTCCCAGTGATGTTTAAA

TCTTGTGGAAATATTTAGGTTTTTAACACATACCCTGTCATAAAGCCTGTATGAGGTCAGAAGACAGGAGCAACACAACTGTCATATTGTGAGTTCCAGT

GCAGGCTTGGCTTTCATTGGTAGCACTGAAAAAAATTACTGCATGGGTATGTTATAGTTCAGTTTTAAAGTTTAAAGGCTTTTTTGAGGCATACCTCAAT

GTTTATGCACACTGGTAATTTAACCACGCCCCCTAAGTATTCTGCATTTGATGCAGCCCAACAAAGCTTCTTTCTGTTCTGAAATAAATTTTGACTATCC

TGTCCATAGCTACAGTACATCATTTGTGACGTAAAGAGTCTTCGTTTCTCAGGTTTCAAACAATTAGTATACATGCTTTTCTTTAGATACAGAATTGGCG

GAGTTAAAAAGAGAACACTGTATAGAACTTTCTGTCTTCCAGGCTTGTTTTTATGCTGCATCGTGAACTGACCGTTGAGCACAGTCCTCTGCATCAGTGC

CCATTCTCTGCTCCTAGGGAACAGATTCTTAAGGTGCAAGTAATTTAAAGACTGAATTTTAAACTAATTATGGCACTGTAGGATCACCTTTATTCATTAA

GAATTGCTTGCTGTGATTCAG
Translation
 - UNI468 - - UNI3377 -  - UNI3377 - - UNI14267 - - UNI17971 -  - UNI2063 - - UNI10810 - - UNI14267 

- - UNI14658 - - UNI17971 -  - UNI4769 - - UNI10810 - - UNI14658 -  - UNI4769 - - UNI14658 - - UNI18

571 -  - UNI4983 - - UNI16829 -  - UNI4983 -  - UNI27659 -   - UNI17360 -  - UNI27605 -  - UNI27605 

-  - UNI4061 - - UNI28761 - - UNI32153 -  - UNI4061 - - UNI18956 - - UNI32153 -  - UNI18956 - - UNI3

2153 -  - UNI6689 -  - UNI6689 -     - UNI9235 -  - UNI9235 - MGGSISQ - UNI27108 - GTPGTYLSSHNQAYPQE

APKPSVGSISLGLPRQQESTKAA - UNI26134 - APLTYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRG - UNI20028 - GTAGAVQEGSITRG

TPASKISVETISSLRGSITQ - UNI20330 - GTPALPQAGIPTEALVKGPVSRMPIEESSPEKVREEAASKGHVIYEGKSGHILSYDS - UNI120

79 - - UNI20330 - - UNI22523 - SLICRALPRGSPHSDLKERTVLSGSIMQG GTPRATAESFEDGLKYPKQIKRESPPIRAFEGAITKGKP

YDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQ - UNI7679 - GTPIKFDNNSGQSAIKHNVKSLITGPSKLPRGMLEIVPEN

IKVVERGKYEDVKAGEPVRARHTSVVSSGPSVLRSTLHEAPKAQLSPGLYDDSSARRTPVSYQNTISRGSPMMNRTSDV VSSSKSASHERKSTLTPTQR

ESIPAKSPVPGVDPVVSHSPFDPHHRSSAAGEVYRSHLPTHLDPAMPFHRALDPA - UNI290 - - UNI29379 - AAAAYLLQRQLSPTPGYPSQ

YQLYAMENTRQTILNDYITSQQMQVNLRPDVTRGLSPREQPLGLPYPATRG GIIDLTNMPPTILVPHAGGTSTPPMDRITYIPGTQVTFPPRPYNAASL

SPG GHPTHLAAAASAEREREREREKERERERERERERERERIAAAPADLYLRPG GSEQPGRPGSHGYVRSPSPSVRTQETILQQRPSVFQGTNGTSVI

TPLDPTAQLRIM MPLPSGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKNLEVEKRSVQCVC

TSSALPSGKAQPHASVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSL - UNI2493 - LSSHRYET

ASDAIEVISPASSPAPPQEKPQAYQPDMVKANQAEN NESTRQYEGPLHHYRSQQESPSPQQQPPLPPSSQSEGMGQVPRTHRLITLADHIC QIITQDF

ARNQVPSQPSTSTFQTSPSALSSTPVRTKTSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGR RPGKSPERSHIPSEPYEPISPPQGPAVHEKQDSML

LLSQRGVDPAEQR - UNI5550 - RSDSRSPGSISYLPSFFTKLESTSPMVKSKKQEIFRKLNSSGGGDSDMA - UNI5550 - AAAQPGTEIFNL

PAVTTSG GAVSSRSHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSHPVGIMPGSASTSVVTSSEARRDEGEPSPHAG GVCKPKLINKSNSRKS

KSPIPGQSYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTG - UNI160 - - UNI27798 - GSTQFPYNPLTIRMLSSTPPTQIACAPSAIT

QAAPHQQNRIWEREPAPLLSAQYETLSDSDD
Transcript ENSMUST00000037575
Sequence
ATGAGTGCAGCCCGCTATAGTGTCCCTCCAG TCCTCCAACCTGCTCCGCATCAAGTGATAACTAACCTTCCTGAAGGGGTTCGGCTTCCAACAACACGA

CCAACCAGGCCACCACCTCCCCTCATCCCATCATCTAAAACCACAGTGGCATCAGAAAAACCATCCTTTATAATGGGAGGGTCTATCTCACAG - UNI2

7108 - GGAACTCCTGGCACTTACTTGTCTTCTCATAATCAGGCTTATCCACAAGAAGCCCCTAAGCCCTCCGTGGGGTCTATCTCTCTGGGATTGCCC

CGGCAGCAGGAGTCTACCAAAGCAG - UNI26134 - CTCCTTTGACCTACATCAAGCAGGAAGAATTTTCTCCGAGAAGCCAAAACTCACAACCTGA

GGGTTTATTGGTCAGAGCGCAGCATGAAGGTGTGGTCAGAG - UNI20028 - GCACTGCAGGGGCTGTCCAAGAAGGAAGTATAACTCGGGGAACTC

CAGCCAGCAAAATCTCAGTGGAGACCATTTCATCGTTGCGGGGCTCTATTACCCAG - UNI20330 - GGGACCCCAGCTCTGCCCCAGGCTGGAATA

CCAACAGAGGCTTTGGTGAAGGGACCTGTCTCCAGGATGCCTATTGAAGAAAGCAGTCCTGAGAAGGTCAGAGAGGAAGCTGCATCCAAGGGCCATGTTA

TCTATGAAGGCAAAAGTGGACATATCTTATCATATGATA - UNI12079 - - UNI20330 - - UNI22523 - GTCTGATATGCCGAGCATTAC

CCAGGGGGAGCCCTCATTCTGACCTCAAAGAGAGGACTGTGCTGTCTGGTTCCATAATGCAGG GCACACCAAGAGCCACAGCGGAAAGCTTTGAGGACG

GCCTTAAATACCCCAAACAGATAAAAAGGGAGAGCCCTCCCATCCGAGCATTTGAAGGTGCCATTACCAAAGGAAAACCATACGATGGTATCACCACCAT

CAAAGAAATGGGGCGCTCCATCCATGAAATCCCACGGCAAGATATTCTAACTCAGGAAAGCCGGAAAACTCCAGAAGTGGTCCAGAGCACGAGGCCAATA

ATTGAGGGTTCCATTTCCCAG - UNI7679 - GGCACACCAATAAAATTTGACAACAACTCAGGTCAATCAGCTATCAAACACAATGTGAAGTCCTTA

ATCACAGGGCCTAGCAAACTACCCCGTGGAATGCTGGAAATTGTACCAGAGAACATAAAAGTAGTAGAACGGGGAAAATATGAGGATGTGAAAGCAGGCG

AGCCAGTGCGAGCCCGGCACACGTCAGTGGTGAGCTCTGGCCCCTCCGTTCTCAGGTCTACACTTCACGAAGCTCCCAAAGCACAGCTGAGCCCGGGACT

CTATGATGACAGCAGCGCTCGCAGGACTCCTGTGAGCTACCAGAACACCATATCCAGAGGCTCCCCCATGATGAACAGAACTTCTGATG TTTCTTCCAG

CAAGTCTGCCAGTCATGAAAGGAAATCAACTCTGACCCCAACCCAAAGAGAAAGTATACCAGCCAAGTCTCCAGTGCCCGGGGTGGATCCCGTCGTGAGT

CACAGCCCATTTGATCCTCATCACAGGAGTAGCGCTGCAGGAGAGGTTTATCGGAGCCACCTACCCACGCACTTGGATCCAGCTATGCCCTTTCACAGGG

CTTTGGATCCTG - UNI290 - - UNI29379 - CAGCTGCTGCTTACCTGTTACAGAGACAGCTTTCACCAACCCCAGGATACCCAAGTCAGTACC

AGCTCTATGCAATGGAGAATACAAGGCAGACAATCCTCAACGATTACATTACCTCACAGCAGATGCAGGTGAATCTGCGCCCTGATGTCACCAGGGGACT

GTCCCCACGAGAGCAGCCACTGGGGCTCCCTTACCCAGCTACAAGAG GAATCATTGACCTGACCAATATGCCTCCAACAATCTTAGTGCCTCATGCAGG

GGGAACGAGCACCCCTCCCATGGACAGGATCACGTATATTCCTGGTACACAGGTTACTTTCCCTCCCAGGCCATATAACGCTGCTTCTCTGTCTCCAG G

ACACCCAACACACCTTGCAGCAGCTGCAAGTGCTGAGAGGGAACGAGAGCGGGAAAGGGAGAAGGAGCGCGAACGTGAGCGCGAGCGTGAGCGTGAACGT

GAACGCGAAAGGATCGCTGCTGCTCCCGCTGACCTCTACCTACGACCAG GTTCAGAACAGCCAGGCCGTCCTGGCAGCCACGGATATGTTCGCTCCCCT

TCCCCTTCAGTAAGAACTCAGGAGACCATCCTGCAACAGAGACCCAGTGTTTTCCAGGGCACCAATGGAACCAGTGTAATCACACCTTTGGACCCAACTG

CTCAGCTACGCATCAT GCCACTGCCTTCTGGGGGCCCTTCCATAAGTCAAGGCCTGCCAGCCTCCCGTTACAACACTGCTGCGGATGCCCTGGCTGCTC

TTGTGGATGCTGCAGCTTCTGCACCCCAGATGGATGTTTCCAAAACAAAAGAGAGTAAGCATGAAGCTGCCAGGTTAGAAGAAAATTTGAGAAGCAGGTC

AGCAGCAGTTAGTGAACAGCAGCAGCTAGAGCAGAAAAACCTGGAGGTGGAGAAGAGATCTGTTCAGTGTGTGTGCACTTCTTCAGCCCTTCCAAGTGGC

AAGGCCCAGCCTCATGCCTCAGTAGTGTATTCTGAGGCTGGGAAAGATAAAGGGCCTCCTCCAAAATCCAGATATGAGGAAGAGCTAAGGACCCGAGGGA

AGACTACCATTACTGCAGCTAACTTCATAGACGTGATCATCACCCGGCAAATTGCCTCGGACAAGGATGCGAGGGAACGTGGCTCTCAAAGTTCAGACTC

TTCTAGTAGCT - UNI2493 - TGTCTTCTCACAGGTATGAAACGGCTAGTGATGCCATTGAGGTGATAAGTCCCGCCAGCTCACCTGCACCACCCCA

GGAAAAGCCACAGGCCTATCAGCCAGACATGGTTAAGGCAAATCAAGCAGAAA ATGAGTCCACTCGACAGTATGAAGGTCCACTGCATCATTATCGGTC

CCAGCAGGAATCACCATCTCCACAGCAACAGCCACCACTGCCCCCATCTTCCCAGTCAGAGGGAATGGGACAGGTGCCCAGGACCCATCGACTGATCACA

CTTGCTGACCACATCTGT CAAATTATCACACAAGATTTTGCTAGAAATCAAGTTCCCTCGCAGCCTTCTACTTCTACATTCCAAACTTCACCATCTGCT

TTGTCATCCACACCTGTAAGAACTAAAACCTCAAGCCGCTACAGCCCAGAATCACAGTCTCAGACTGTCTTGCATCCCAGACCAGGTCCTAGAGTCTCTC

CAGAAAATCTTGTGGATAAATCCCGGGGAAG GCCTGGAAAATCTCCAGAGAGGAGTCATATCCCATCAGAGCCCTATGAGCCCATCTCCCCACCCCAAG

GCCCTGCTGTGCATGAGAAGCAGGACAGCATGTTGCTCTTGTCACAGAGGGGAGTGGACCCTGCTGAGCAAAG - UNI5550 - GAGTGATTCTCGAT

CACCAGGAAGTATAAGCTACTTGCCTTCATTCTTCACCAAGCTTGAAAGCACATCACCCATGGTTAAATCAAAGAAACAGGAAATTTTTCGTAAGTTGAA

CTCTTCTGGTGGAGGTGACTCTGATATGG - UNI5550 - CAGCTGCTCAGCCAGGAACAGAGATCTTCAATCTGCCAGCAGTTACCACATCAG GTG

CAGTGAGCTCAAGAAGCCATTCTTTTGCTGATCCCGCCAGTAACCTTGGTCTAGAAGACATCATCAGAAAGGCTCTCATGGGAAGTTTTGATGATAAAGT

TGAAGATCATGGTGTTGTCATGTCCCATCCTGTGGGCATTATGCCTGGTAGTGCCAGCACCTCAGTGGTGACGAGCAGCGAGGCACGGAGAGATGAAGGG

GAGCCATCACCTCATGCAG GAGTATGCAAACCAAAGCTGATCAACAAATCAAACAGCAGGAAGTCTAAATCTCCTATTCCTGGGCAAAGCTATTTAGGA

ACTGAAAGGCCTTCTTCTGTCTCCTCTGTGCATTCAGAAGGTGATTACCACAGGCAGACACCAGGATGGGCATGGGAAGATCGGCCCTCTTCAACAG - 

UNI160 - - UNI27798 - GTTCTACTCAGTTCCCTTACAACCCTCTGACCATACGGATGCTCAGCAGTACACCACCTACACAGATCGCATGCGCCC

CATCTGCCATCACCCAAGCAGCTCCACATCAACAGAACCGCATCTGGGAGAGGGAGCCTGCCCCGCTCCTCTCAGCGCAGTATGAGACACTGTCTGATAG

TGACGACTGAGCTGTGCGTGGGAGAGCGCTCTGGCTTTGGTTTTTATTGAAGATTTAAAAAAAAAAAAAGAAAATTATTCTGCCCTCCCATGATTTGTGC

CCAGAGACTTCTCAGGAGAGCCAGGGCCATGGATGAGGAAGAAATGATGGAAATTCATTTGGAAAATCAAATGGGAAAAAACAAACAAAAAAACTGCCTC

TAATACAGGCACTTCAATGGATTATAACAGTGGCGGGTTGAAGTGTAGAGTTTTTTTAAAGTGGACAATTCTTGTTCTTACATCTGTTTGTAAAGAAAAC

CATGATGTCTTTAAATCAATCTTCTGTAAATAGATGACTTTTTTGCAGTGTATCCCCTTGCTGTAGTATCTGGTGTACTTAAATTTAAATCAGCGAATCA

ACTGGGGAGAATTTTTAAAATTCTTTGTGTATCTTTTTAACCCCAGCCTCTAAACCTCACACAGCCCAGTTCCACAGTGCTGGCTGTCATGGGCATTGTA

CTTTTGTTTCCTCTAAATTCAGCTTTCCCAGTGATGTTTAAATCTTGTGGAAATATTTAGGTTTTTAACACATACCCTGTCATAAAGCCTGTATGAGGTC

AGAAGACAGGAGCAACACAACTGTCATATTGTGAGTTCCAGTGCAGGCTTGGCTTTCATTGGTAGCACTGAAAAAAATTACTGCATGGGTATGTTATAGT

TCAGTTTTAAAGTTTAAAGGCTTTTTTGAGGCATACCTCAATGTTTATGCACACTGGTAATTTAACCACGCCCCCTAAGTATTCTGCATTTGATGCAGCC

CAACAAAGCTTCTTTCTGTTCTGAAATAAATTTTGACTATCCTGTCCATAGCTACAGTACATCATTTGTGACGTAAAGAGTCTTCGTTTCTCAGGTTTCA

AACAATTAGTATACATGCTTTTCTTTAGATACAGAATTGGCGGAGTTAAAAAGAGAACACTGTATAGAACTTTCTGTCTTCCAGGCTTGTTTTTATGCTG

CATCGTGAACTGACCGTTGAGCACAGTCCTCTGCATCAGTGCCCATTCTCTGCTCCTAGGGAACAGATTCTTAAGGTGCAAGTAATTTAAAGACTGAATT

TTAAACTAATTATGGCACTGTAGGATCACCTTTATTCATTAAGAATTGCTTGCTGTGATTCAG
Translation
MSAARYSVPPV VLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQ - UNI27108 - GTPGTYLSSHNQAYPQEAPK

PSVGSISLGLPRQQESTKAA - UNI26134 - APLTYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRG - UNI20028 - GTAGAVQEGSITRGTPA

SKISVETISSLRGSITQ - UNI20330 - GTPALPQAGIPTEALVKGPVSRMPIEESSPEKVREEAASKGHVIYEGKSGHILSYDS - UNI12079 

- - UNI20330 - - UNI22523 - SLICRALPRGSPHSDLKERTVLSGSIMQG GTPRATAESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDG

ITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQ - UNI7679 - GTPIKFDNNSGQSAIKHNVKSLITGPSKLPRGMLEIVPENIKV

VERGKYEDVKAGEPVRARHTSVVSSGPSVLRSTLHEAPKAQLSPGLYDDSSARRTPVSYQNTISRGSPMMNRTSDV VSSSKSASHERKSTLTPTQRESI

PAKSPVPGVDPVVSHSPFDPHHRSSAAGEVYRSHLPTHLDPAMPFHRALDPA - UNI290 - - UNI29379 - AAAAYLLQRQLSPTPGYPSQYQL

YAMENTRQTILNDYITSQQMQVNLRPDVTRGLSPREQPLGLPYPATRG GIIDLTNMPPTILVPHAGGTSTPPMDRITYIPGTQVTFPPRPYNAASLSPG

 GHPTHLAAAASAEREREREREKERERERERERERERERIAAAPADLYLRPG GSEQPGRPGSHGYVRSPSPSVRTQETILQQRPSVFQGTNGTSVITPL

DPTAQLRIM MPLPSGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKNLEVEKRSVQCVCTSS

ALPSGKAQPHASVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSL - UNI2493 - LSSHRYETASD

AIEVISPASSPAPPQEKPQAYQPDMVKANQAEN NESTRQYEGPLHHYRSQQESPSPQQQPPLPPSSQSEGMGQVPRTHRLITLADHIC QIITQDFARN

QVPSQPSTSTFQTSPSALSSTPVRTKTSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGR RPGKSPERSHIPSEPYEPISPPQGPAVHEKQDSMLLLS

QRGVDPAEQR - UNI5550 - RSDSRSPGSISYLPSFFTKLESTSPMVKSKKQEIFRKLNSSGGGDSDMA - UNI5550 - AAAQPGTEIFNLPAV

TTSG GAVSSRSHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSHPVGIMPGSASTSVVTSSEARRDEGEPSPHAG GVCKPKLINKSNSRKSKSP

IPGQSYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTG - UNI160 - - UNI27798 - GSTQFPYNPLTIRMLSSTPPTQIACAPSAITQAA

PHQQNRIWEREPAPLLSAQYETLSDSDD
Transcript ENSMUST00000101067
Sequence
TTGGACTTGATCTCACAGCCCAGTGAGGACGTCTTTACTGATAATGTCAAGTTCAGGTTACCCTCCCAACCAAGGAGCTTTCAGCACAGAGCAAAGTCGT

TATCCTTCACATTCTGTCCAGTATACCTTTCCCAGTACCCGACACCAGCAG - UNI3377 - - UNI14267 - - UNI17971 - GAATTTGCAG

TTCCTGACTACCGCTCTTCTCATATTGAAGTTAGCCAGGCATCACAGCTTTTACAGCAGCAGCAGCAGCAGCAGCAGCTTCGAAGACGACCTTCCTTGCT

TTCAGAATTTCACCCGGGTTCTGACAG - UNI2063 - - UNI10810 - - UNI14267 - - UNI14658 - - UNI17971 - GCCTCAAG

AAAGGAGAACTGGATATGAACAGTTTCACTCAGGACCCTCACCGGTGGATCATGATTCCTTGGAGTCCAAGCGCCCACGCCTGGAGCCAGTTTCTGATGC

CCATTTCCAGCGTGTTAGTGCTGCGGTTTTACCTTTAGTTCACTCGCTGCCAGAAGGCTTGAGGTCGTCTGCAGATGCTAAGAAG - UNI4769 - - 

UNI10810 - - UNI14658 - GATTCAGCATTTGGAAGCAAACATGAAGCTCCATCCTCTCCTTTGGCTGGGCAACCATGTGGAGATGACCAAAATG

CTTCACCTTCAAAGCTTTCAAAGGAGGAGTTAATACAGAGTATGGACCGGGTAGACCGAGAGATTGCAAAAGTAGAGCAGCAGATCCTTAAATTGAAAAA

GAAACAA - UNI4769 - - UNI14658 - - UNI18571 - CAACAGCTAGAAGAAGAAGCAGCTAAGCCCCCTGAACCAGAGAAGCCTGTGTCC

CCTCCTCCTGTGGAACAAAAACACCGTAGTATTGTCCAAATTATTTATGATGAGAATCGG - UNI4983 - - UNI16829 - AAAAAAGCAGAAGA

AGCTCATAAAATATTTGAAGGTCTTGGCCCAAAAGTTGAACTG - UNI4983 - CCACTCTATAACCAGCCATCAGATACCAAGGTGTACCATGAGAA

CATCAAGAC - UNI27659 - AAACCAGGTGATGAGGAAAAAACTCATTTTATTTTTTAAAAGAAGAAATCATGCAAGAAAACAAAGG GAACAAAAA

ATCTGCCAGCGCTATGATCAGCTCATGGAAGCGTGGGAGAAAAAAGTGGACAGAATAGAAAATAATCCCCGGAGGAAAGCAAAAGAAAGCAAAACAAGGG

AATACTATGAGAAGCAGTTTCCAGAAATTCGAAAACAAAGAGAACAGCAAGAAAGATTTCAGCG - UNI17360 - AGTTGGTCAGAGGGGAGCTGGT

CTTTCAGCCACCATTGCTAGGAGTGAGCATGAGATTTCTGAAATTATTGATGGTCTTTCTGAACAGGAG - UNI27605 - AATAATGAGAAGCAAAT

GCGTCAGCTTTCTGTGATTCCACCTATGATGTTTGATGCAGAACAAAGAAGGGTCAAATTCATCAATATGAATGGGCTGATGGAGGATCCAATGAAGGTT

TATAAAGACAGACAGTTTATGAATGTTTGGACTGACCATGAAAAGGAGATCTTTAAGGACAA - UNI27605 - GTTTATCCAGCATCCAAAAAACTT

TGGACTAATTGCATCCTATTTGGAAAGGAAG - UNI4061 - - UNI28761 - - UNI32153 - AGTGTTCCTGATTGTGTTTTATATTACTAT

TTAACCAAGAAAAATGAGAATTATAAGGCCCTCGTGAGAAGGAATTATGGAAAACGCAGAGGCAGAAATCAG - UNI4061 - - UNI18956 - - 

UNI32153 - CAGATTGCCCGTCCCTCACAAGAAGAAAAAGTAGAAGAAAAGGAAGAGGATAAAGCAGAAAAAACAGAGAAAAAGGAAGAAGAAAAGAA

GGATGATGAAGAAAAAGATGATAAGGAAGACTCTAA - UNI18956 - - UNI32153 - AGAAACAACCAAGGAAAAGGACAGAACGGAAGCCACA

GCAGAAGAACCTGAAGAAAGAGAGCAGGTCACTCCAAGGGGGCGAAAGACTGCTAACAGCCAAGGCCGCCGGAAGGGCCGGGTCACCAGGTCGATGACAA

GTGAAGCTGCAGCTGCCAATGCTGCTGCTGCAGCCACTGAGGAGCCCCCGCCACCCCTGCCGCCACCACCAGAGCCCA - UNI6689 - TTTCTACAG

AACCTGTTGAGACTTCAAGATGGACAGAAGAAGAAATGGAAGTTGCTAAAAAAG - UNI6689 - GCCTGGTAGAACATGGTCGTAACTGGGCAGCCA

TTGCTAAAATGGTGGGAACTAAAAGTGAAGCCCAGTGCAAAAACTTCTATTTTAACTATAAAAGACGGCATAATCTTGACAACCTTTTGCAGCAACATAA

ACAGAAA GCTTCACGGAAACCCCGTGAGGAACGAGATGTATCTCAGTGTGAAAGTGTTGCTTCCACTGTTTCTGCCCAAGAGGATGAAGATATTGAAGC

CTCAAATGAGGAGGAAAATCCAGAAGATAGTGAAG GTGCTGAAAATAGTTCTGATACAGAAAGTGCTCCCTCTCCTTCACCAGTTGAAGCTGCCAAGTC

CAGTGAAGACAGCAGTGAAAATGCTGCTTCTCGAGGAAACACCGAGCCTGTGGCTGAGCTTGAGGCCACCACTGACCCTGCACCCTGTGCATCTCCCTCT

TCAGCAGTTCCAACCACAAAACCAGCAGAAAGGGAAAGCGTGGAGGCCCAGGTGACCGACAGCGCCAGTGCTGAGACCGCAGAGCCGATGGACGTAGACC

ATGAGGAGTGCGGTGCCGAGGGCAGTTCTGTTCTTGATCCACCAGCCCCTACCAAAGCCGACTCCGTGGACCCAGAAATGCAGGTACCAGAAAATACTGC

GTCTAAAGGTGAAGGGGATGCCAAGGAAAGAGACTTGGAGAGCACCAGTGAGAAGACAGAGGCTAGAGATGAAGACGTGGTAGTGGCTGAACAGATCGAG

AGGCCTGAGCCACAGTCAGACGACGACTCCAGTGCCACTTGCAGTGCGGATGAGGGTGTGGATGGAGAGCCAGAGAGGCAGAG AGTGTTTCCCATGGAT

GCAAAGCCTTCATTGTTAACTCCTCCTGGATCTATCCTAATCTCATCCCCTATTAAACCAAACCCATTGGATCTGCCACAGCTTCAGCATCGAGCTGCTG

TTATTCCACCAATG - UNI9235 - GTTTCTTGCACTCCATGTAATATACCAATTGGAACGCCCGTAAGTGGCTATGCTCTTTACCAACGGCACATTA

AGGCCATGCATGAGTCAGCACTCCTGGAGGAGCAGCGGCAGAGGCAAGAACAGGTAGACTTGGAATGCAGAAGCTCTACAAGCCCATGCAGCACTTCTAA

GAGTCCAAACAGGGAGTGGGAAG - UNI9235 - TCCTCCAACCTGCTCCGCATCAAGTGATAACTAACCTTCCTGAAGGGGTTCGGCTTCCAACAAC

ACGACCAACCAGGCCACCACCTCCCCTCATCCCATCATCTAAAACCACAGTGGCATCAGAAAAACCATCCTTTATAATGGGAGGGTCTATCTCACAG - 

UNI27108 - GGAACTCCTGGCACTTACTTGTCTTCTCATAATCAGGCTTATCCACAAGAAGCCCCTAAGCCCTCCGTGGGGTCTATCTCTCTGGGATT

GCCCCGGCAGCAGGAGTCTACCAAAGCAG - UNI26134 - CTCCTTTGACCTACATCAAGCAGGAAGAATTTTCTCCGAGAAGCCAAAACTCACAAC

CTGAGGGTTTATTGGTCAGAGCGCAGCATGAAGGTGTGGTCAGAG - UNI20028 - GCACTGCAGGGGCTGTCCAAGAAGGAAGTATAACTCGGGGA

ACTCCAGCCAGCAAAATCTCAGTGGAGACCATTTCATCGTTGCGGGGCTCTATTACCCAG - UNI20330 - GGGACCCCAGCTCTGCCCCAGGCTGG

AATACCAACAGAGGCTTTGGTGAAGGGACCTGTCTCCAGGATGCCTATTGAAGAAAGCAGTCCTGAGAAGGTCAGAGAGGAAGCTGCATCCAAGGGCCAT

GTTATCTATGAAGGCAAAAGTGGACATATCTTATCATATGATA - UNI12079 - - UNI20330 - ATATTAAGAATGCCCGAGAAGGGACTCGGA

GTCCAAGAACAGCTCATGAAATGAGTTTAAAAAGAAGCTATGAGGCAGTGGAAGGAAGTATAAAGCAAGGCATGTCGATGAGGGAGTCTCCTGTGTCAGC

ACCTTTAGAGG - UNI22523 - GTCTGATATGCCGAGCATTACCCAGGGGGAGCCCTCATTCTGACCTCAAAGAGAGGACTGTGCTGTCTGGTTCCA

TAATGCAGG GCACACCAAGAGCCACAGCGGAAAGCTTTGAGGACGGCCTTAAATACCCCAAACAGATAAAAAGGGAGAGCCCTCCCATCCGAGCATTTG

AAGGTGCCATTACCAAAGGAAAACCATACGATGGTATCACCACCATCAAAGAAATGGGGCGCTCCATCCATGAAATCCCACGGCAAGATATTCTAACTCA

GGAAAGCCGGAAAACTCCAGAAGTGGTCCAGAGCACGAGGCCAATAATTGAGGGTTCCATTTCCCAG - UNI7679 - GGCACACCAATAAAATTTGA

CAACAACTCAGGTCAATCAGCTATCAAACACAATGTGAAGTCCTTAATCACAGGGCCTAGCAAACTACCCCGTGGAATGCTGGAAATTGTACCAGAGAAC

ATAAAAGTAGTAGAACGGGGAAAATATGAGGATGTGAAAGCAGGCGAGCCAGTGCGAGCCCGGCACACGTCAGTGGTGAGCTCTGGCCCCTCCGTTCTCA

GGTCTACACTTCACGAAGCTCCCAAAGCACAGCTGAGCCCGGGACTCTATGATGACAGCAGCGCTCGCAGGACTCCTGTGAGCTACCAGAACACCATATC

CAGAGGCTCCCCCATGATGAACAGAACTTCTGATG TTTCTTCCAGCAAGTCTGCCAGTCATGAAAGGAAATCAACTCTGACCCCAACCCAAAGAGAAAG

TATACCAGCCAAGTCTCCAGTGCCCGGGGTGGATCCCGTCGTGAGTCACAGCCCATTTGATCCTCATCACAGGAGTAGCGCTGCAGGAGAGGTTTATCGG

AGCCACCTACCCACGCACTTGGATCCAGCTATGCCCTTTCACAGGGCTTTGGATCCTG - UNI290 - - UNI29379 - CTGCTGCTTACCTGTTA

CAGAGACAGCTTTCACCAACCCCAGGATACCCAAGTCAGTACCAGCTCTATGCAATGGAGAATACAAGGCAGACAATCCTCAACGATTACATTACCTCAC

AGCAGATGCAGGTGAATCTGCGCCCTGATGTCACCAGGGGACTGTCCCCACGAGAGCAGCCACTGGGGCTCCCTTACCCAGCTACAAGAG GAATCATTG

ACCTGACCAATATGCCTCCAACAATCTTAGTGCCTCATGCAGGGGGAACGAGCACCCCTCCCATGGACAGGATCACGTATATTCCTGGTACACAGGTTAC

TTTCCCTCCCAGGCCATATAACGCTGCTTCTCTGTCTCCAG GACACCCAACACACCTTGCAGCAGCTGCAAGTGCTGAGAGGGAACGAGAGCGGGAAAG

GGAGAAGGAGCGCGAACGTGAGCGCGAGCGTGAGCGTGAACGTGAACGCGAAAGGATCGCTGCTGCTCCCGCTGACCTCTACCTACGACCAG GTTCAGA

ACAGCCAGGCCGTCCTGGCAGCCACGGATATGTTCGCTCCCCTTCCCCTTCAGTAAGAACTCAGGAGACCATCCTGCAACAGAGACCCAGTGTTTTCCAG

GGCACCAATGGAACCAGTGTAATCACACCTTTGGACCCAACTGCTCAGCTACGCATCAT GCCACTGCCTTCTGGGGGCCCTTCCATAAGTCAAGGCCTG

CCAGCCTCCCGTTACAACACTGCTGCGGATGCCCTGGCTGCTCTTGTGGATGCTGCAGCTTCTGCACCCCAGATGGATGTTTCCAAAACAAAAGAGA - 

UNI2493 - TGTCTTCTCACAGGTATGAAACGGCTAGTGATGCCATTGAGGTGATAAGTCCCGCCAGCTCACCTGCACCACCCCAGGAAAAGCCACAGG

CCTATCAGCCAGACATGGTTAAGGCAAATCAAGCAGAAA ATGAGTCCACTCGACAGTATGAAGGTCCACTGCATCATTATCGGTCCCAGCAGGAATCAC

CATCTCCACAGCAACAGCCACCACTGCCCCCATCTTCCCAGTCAGAGGGAATGGGACAGGTGCCCAGGACCCATCGACTGATCACACTTGCTGACCACAT

CTGT CAAATTATCACACAAGATTTTGCTAGAAATCAAGTTCCCTCGCAGCCTTCTACTTCTACATTCCAAACTTCACCATCTGCTTTGTCATCCACACC

TGTAAGAACTAAAACCTCAAGCCGCTACAGCCCAGAATCACAGTCTCAGACTGTCTTGCATCCCAGACCAGGTCCTAGAGTCTCTCCAGAAAATCTTGTG

GATAAATCCCGGGGAAG CAGGCCTGGAAAATCTCCAGAGAGGAGTCATATCCCATCAGAGCCCTATGAGCCCATCTCCCCACCCCAAGGCCCTGCTGTG

CATGAGAAGCAGGACAGCATGTTGCTCTTGTCACAGAGGGGAGTGGACCCTGCTGAGCAAAG - UNI5550 - GAGTGATTCTCGATCACCAGGAAGT

ATAAGCTACTTGCCTTCATTCTTCACCAAGCTTGAAAGCACATCACCCATGGTTAAATCAAAGAAACAGGAAATTTTTCGTAAGTTGAACTCTTCTGGTG

GAGGTGACTCTGATATGG - UNI5550 - CAGCTGCTCAGCCAGGAACAGAGATCTTCAATCTGCCAGCAGTTACCACATCAG GTGCAGTGAGCTCA

AGAAGCCATTCTTTTGCTGATCCCGCCAGTAACCTTGGTCTAGAAGACATCATCAGAAAGGCTCTCATGGGAAGTTTTGATGATAAAGTTGAAGATCATG

GTGTTGTCATGTCCCATCCTGTGGGCATTATGCCTGGTAGTGCCAGCACCTCAGTGGTGACGAGCAGCGAGGCACGGAGAGATGAAGGGGAGCCATCACC

TCATGCAG GAGTATGCAAACCAAAGCTGATCAACAAATCAAACAGCAGGAAGTCTAAATCTCCTATTCCTGGGCAAAGCTATTTAGGAACTGAAAGGCC

TTCTTCTGTCTCCTCTGTGCATTCAGAAGGTGATTACCACAGGCAGACACCAGGATGGGCATGGGAAGATCGGCCCTCTTCAACAG - UNI160 - - 

UNI27798 - GTTCTACTCAGTTCCCTTACAACCCTCTGACCATACGGATGCTCAGCAGTACACCACCTACACAGATCGCATGCGCCCCATCTGCCATC

ACCCAAGCAGCTCCACATCAACAGAACCGCATCTGGGAGAGGGAGCCTGCCCCGCTCCTCTCAGCGCAGTATGAGACACTGTCTGATAGTGACGACTGAG

CTGTGC
Translation
MSSSGYPPNQGAFSTEQSRYPSHSVQYTFPSTRHQQ - UNI3377 - - UNI14267 - - UNI17971 - EFAVPDYRSSHIEVSQASQLLQQQQ

QQQQLRRRPSLLSEFHPGSDR - UNI2063 - - UNI10810 - - UNI14267 - - UNI14658 - - UNI17971 - RPQERRTGYEQFHS

GPSPVDHDSLESKRPRLEPVSDAHFQRVSAAVLPLVHSLPEGLRSSADAKK - UNI4769 - - UNI10810 - - UNI14658 - DSAFGSKHEA

PSSPLAGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQ - UNI4769 - - UNI14658 - - UNI18571 - QQLEEEAAKP

PEPEKPVSPPPVEQKHRSIVQIIYDENR - UNI4983 - - UNI16829 - KKAEEAHKIFEGLGPKVEL - UNI4983 - PLYNQPSDTKVYHE

NIKT - UNI27659 - TNQVMRKKLILFFKRRNHARKQR EQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQR

 - UNI17360 - RVGQRGAGLSATIARSEHEISEIIDGLSEQE - UNI27605 - NNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYK

DRQFMNVWTDHEKEIFKDK - UNI27605 - KFIQHPKNFGLIASYLERK - UNI4061 - - UNI28761 - - UNI32153 - SVPDCVLYY

YLTKKNENYKALVRRNYGKRRGRNQ - UNI4061 - - UNI18956 - - UNI32153 - QIARPSQEEKVEEKEEDKAEKTEKKEEEKKDDEEKD

DKEDSK - UNI18956 - - UNI32153 - KETTKEKDRTEATAEEPEEREQVTPRGRKTANSQGRRKGRVTRSMTSEAAAANAAAAATEEPPPPLP

PPPEPI - UNI6689 - ISTEPVETSRWTEEEMEVAKKG - UNI6689 - GLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQ

K ASRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEG GAENSSDTESAPSPSPVEAAKSSEDSSENAASRGNTEPVAELEATTDPAPCASP

SSAVPTTKPAERESVEAQVTDSASAETAEPMDVDHEECGAEGSSVLDPPAPTKADSVDPEMQVPENTASKGEGDAKERDLESTSEKTEARDEDVVVAEQI

ERPEPQSDDDSSATCSADEGVDGEPERQR RVFPMDAKPSLLTPPGSILISSPIKPNPLDLPQLQHRAAVIPPM - UNI9235 - VSCTPCNIPIGTP

VSGYALYQRHIKAMHESALLEEQRQRQEQVDLECRSSTSPCSTSKSPNREWEV - UNI9235 - VLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPS

SKTTVASEKPSFIMGGSISQ - UNI27108 - GTPGTYLSSHNQAYPQEAPKPSVGSISLGLPRQQESTKAA - UNI26134 - APLTYIKQEEFS

PRSQNSQPEGLLVRAQHEGVVRG - UNI20028 - GTAGAVQEGSITRGTPASKISVETISSLRGSITQ - UNI20330 - GTPALPQAGIPTEAL

VKGPVSRMPIEESSPEKVREEAASKGHVIYEGKSGHILSYDN - UNI12079 - - UNI20330 - NIKNAREGTRSPRTAHEMSLKRSYEAVEGSI

KQGMSMRESPVSAPLEG - UNI22523 - GLICRALPRGSPHSDLKERTVLSGSIMQG GTPRATAESFEDGLKYPKQIKRESPPIRAFEGAITKGKP

YDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQ - UNI7679 - GTPIKFDNNSGQSAIKHNVKSLITGPSKLPRGMLEIVPEN

IKVVERGKYEDVKAGEPVRARHTSVVSSGPSVLRSTLHEAPKAQLSPGLYDDSSARRTPVSYQNTISRGSPMMNRTSDV VSSSKSASHERKSTLTPTQR

ESIPAKSPVPGVDPVVSHSPFDPHHRSSAAGEVYRSHLPTHLDPAMPFHRALDPA - UNI290 - - UNI29379 - AAAYLLQRQLSPTPGYPSQY

QLYAMENTRQTILNDYITSQQMQVNLRPDVTRGLSPREQPLGLPYPATRG GIIDLTNMPPTILVPHAGGTSTPPMDRITYIPGTQVTFPPRPYNAASLS

PG GHPTHLAAAASAEREREREREKERERERERERERERERIAAAPADLYLRPG GSEQPGRPGSHGYVRSPSPSVRTQETILQQRPSVFQGTNGTSVIT

PLDPTAQLRIM MPLPSGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKEM - UNI2493 - MSSHRYETASDAIEVISPASSPAPPQEK

PQAYQPDMVKANQAEN NESTRQYEGPLHHYRSQQESPSPQQQPPLPPSSQSEGMGQVPRTHRLITLADHIC QIITQDFARNQVPSQPSTSTFQTSPSA

LSSTPVRTKTSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGS SRPGKSPERSHIPSEPYEPISPPQGPAVHEKQDSMLLLSQRGVDPAEQR - UNI

5550 - RSDSRSPGSISYLPSFFTKLESTSPMVKSKKQEIFRKLNSSGGGDSDMA - UNI5550 - AAAQPGTEIFNLPAVTTSG GAVSSRSHSFA

DPASNLGLEDIIRKALMGSFDDKVEDHGVVMSHPVGIMPGSASTSVVTSSEARRDEGEPSPHAG GVCKPKLINKSNSRKSKSPIPGQSYLGTERPSSVS

SVHSEGDYHRQTPGWAWEDRPSSTG - UNI160 - - UNI27798 - GSTQFPYNPLTIRMLSSTPPTQIACAPSAITQAAPHQQNRIWEREPAPLL

SAQYETLSDSDD
Transcript ENSMUST00000018645
Sequence
GAGGGGGAGGGAGTGGGGTTGAGGCAAGATGGCGGCTAAGGTGGCGAAGCTGCGGCGGCGGCGGCTGGAGTGAGCGCCCAGCTCGCCGCGCTGCCGAGCG

AGGGCCGGGCGGAGGGCCGCGCGCCGGGGCCGCGCCCCGGTCGTCCGGCCGTGGGGCGCGCCGGCTCTCACTCCGCCAGCTCCCG - UNI468 - - U

NI3377 - GTTGCTTCCTAGAAACATGGTTGTTTGTTGGACTTGATCTCACAGCCCAGTGAGGACGTCTTTACTGATAATGTCAAGTTCAGGTTACCCT

CCCAACCAAGGAGCTTTCAGCACAGAGCAAAGTCGTTATCCTTCACATTCTGTCCAGTATACCTTTCCCAGTACCCGACACCAGCAG - UNI3377 - 

- UNI14267 - - UNI17971 - GAATTTGCAGTTCCTGACTACCGCTCTTCTCATATTGAAGTTAGCCAGGCATCACAGCTTTTACAGCAGCAGCA

GCAGCAGCAGCAGCTTCGAAGACGACCTTCCTTGCTTTCAGAATTTCACCCGGGTTCTGACAG - UNI2063 - - UNI10810 - - UNI14267 

- - UNI14658 - - UNI17971 - GCCTCAAGAAAGGAGAACTGGATATGAACAGTTTCACTCAGGACCCTCACCGGTGGATCATGATTCCTTGGA

GTCCAAGCGCCCACGCCTGGAGCCAGTTTCTGATGCCCATTTCCAGCGTGTTAGTGCTGCGGTTTTACCTTTAGTTCACTCGCTGCCAGAAGGCTTGAGG

TCGTCTGCAGATGCTAAGAAG - UNI4769 - - UNI10810 - - UNI14658 - GATTCAGCATTTGGAAGCAAACATGAAGCTCCATCCTCTC

CTTTGGCTGGGCAACCATGTGGAGATGACCAAAATGCTTCACCTTCAAAGCTTTCAAAGGAGGAGTTAATACAGAGTATGGACCGGGTAGACCGAGAGAT

TGCAAAAGTAGAGCAGCAGATCCTTAAATTGAAAAAGAAACAA - UNI4769 - - UNI14658 - - UNI18571 - CAACAGCTAGAAGAAGAA

GCAGCTAAGCCCCCTGAACCAGAGAAGCCTGTGTCCCCTCCTCCTGTGGAACAAAAACACCGTAGTATTGTCCAAATTATTTATGATGAGAATCGG - U

NI4983 - - UNI16829 - AAAAAAGCAGAAGAAGCTCATAAAATATTTGAAGGTCTTGGCCCAAAAGTTGAACTG - UNI4983 - CCACTCTA

TAACCAGCCATCAGATACCAAGGTGTACCATGAGAACATCAAGAC - UNI27659 - AAACCAGGTGATGAGGAAAAAACTCATTTTATTTTTTAAAA

GAAGAAATCATGCAAGAAAACAAAGG GAACAAAAAATCTGCCAGCGCTATGATCAGCTCATGGAAGCGTGGGAGAAAAAAGTGGACAGAATAGAAAATA

ATCCCCGGAGGAAAGCAAAAGAAAGCAAAACAAGGGAATACTATGAGAAGCAGTTTCCAGAAATTCGAAAACAAAGAGAACAGCAAGAAAGATTTCAGCG

 - UNI17360 - AGTTGGTCAGAGGGGAGCTGGTCTTTCAGCCACCATTGCTAGGAGTGAGCATGAGATTTCTGAAATTATTGATGGTCTTTCTGAAC

AGGAG - UNI27605 - AATAATGAGAAGCAAATGCGTCAGCTTTCTGTGATTCCACCTATGATGTTTGATGCAGAACAAAGAAGGGTCAAATTCATC

AATATGAATGGGCTGATGGAGGATCCAATGAAGGTTTATAAAGACAGACAGTTTATGAATGTTTGGACTGACCATGAAAAGGAGATCTTTAAGGACAA -

 UNI27605 - GTTTATCCAGCATCCAAAAAACTTTGGACTAATTGCATCCTATTTGGAAAGGAAG - UNI4061 - - UNI28761 - - UNI32

153 - AGTGTTCCTGATTGTGTTTTATATTACTATTTAACCAAGAAAAATGAGAATTATAAGGCCCTCGTGAGAAGGAATTATGGAAAACGCAGAGGCA

GAAATCAG - UNI4061 - - UNI18956 - - UNI32153 - CAGATTGCCCGTCCCTCACAAGAAGAAAAAGTAGAAGAAAAGGAAGAGGATAA

AGCAGAAAAAACAGAGAAAAAGGAAGAAGAAAAGAAGGATGATGAAGAAAAAGATGATAAGGAAGACTCTAA - UNI18956 - - UNI32153 - A

GAAACAACCAAGGAAAAGGACAGAACGGAAGCCACAGCAGAAGAACCTGAAGAAAGAGAGCAGGTCACTCCAAGGGGGCGAAAGACTGCTAACAGCCAAG

GCCGCCGGAAGGGCCGGGTCACCAGGTCGATGACAAGTGAAGCTGCAGCTGCCAATGCTGCTGCTGCAGCCACTGAGGAGCCCCCGCCACCCCTGCCGCC

ACCACCAGAGCCCA - UNI6689 - TTTCTACAGAACCTGTTGAGACTTCAAGATGGACAGAAGAAGAAATGGAAGTTGCTAAAAAAG - UNI6689

 - GCCTGGTAGAACATGGTCGTAACTGGGCAGCCATTGCTAAAATGGTGGGAACTAAAAGTGAAGCCCAGTGCAAAAACTTCTATTTTAACTATAAAAG

ACGGCATAATCTTGACAACCTTTTGCAGCAACATAAACAGAAA GCTTCACGGAAACCCCGTGAGGAACGAGATGTATCTCAGTGTGAAAGTGTTGCTTC

CACTGTTTCTGCCCAAGAGGATGAAGATATTGAAGCCTCAAATGAGGAGGAAAATCCAGAAGATAGTGAAG GTGCTGAAAATAGTTCTGATACAGAAAG

TGCTCCCTCTCCTTCACCAGTTGAAGCTGCCAAGTCCAGTGAAGACAGCAGTGAAAATGCTGCTTCTCGAGGAAACACCGAGCCTGTGGCTGAGCTTGAG

GCCACCACTGACCCTGCACCCTGTGCATCTCCCTCTTCAGCAGTTCCAACCACAAAACCAGCAGAAAGGGAAAGCGTGGAGGCCCAGGTGACCGACAGCG

CCAGTGCTGAGACCGCAGAGCCGATGGACGTAGACCATGAGGAGTGCGGTGCCGAGGGCAGTTCTGTTCTTGATCCACCAGCCCCTACCAAAGCCGACTC

CGTGGACCCAGAAATGCAGGTACCAGAAAATACTGCGTCTAAAGGTGAAGGGGATGCCAAGGAAAGAGACTTGGAGAGCACCAGTGAGAAGACAGAGGCT

AGAGATGAAGACGTGGTAGTGGCTGAACAGATCGAGAGGCCTGAGCCACAGTCAGACGACGACTCCAGTGCCACTTGCAGTGCGGATGAGGGTGTGGATG

GAGAGCCAGAGAGGCAGAG AGTGTTTCCCATGGATGCAAAGCCTTCATTGTTAACTCCTCCTGGATCTATCCTAATCTCATCCCCTATTAAACCAAACC

CATTGGATCTGCCACAGCTTCAGCATCGAGCTGCTGTTATTCCACCAATG - UNI9235 - GTTTCTTGCACTCCATGTAATATACCAATTGGAACGC

CCGTAAGTGGCTATGCTCTTTACCAACGGCACATTAAGGCCATGCATGAGTCAGCACTCCTGGAGGAGCAGCGGCAGAGGCAAGAACAGGTAGACTTGGA

ATGCAGAAGCTCTACAAGCCCATGCAGCACTTCTAAGAGTCCAAACAGGGAGTGGGAAG - UNI9235 - TCCTCCAACCTGCTCCGCATCAAGTGAT

AACTAACCTTCCTGAAGGGGTTCGGCTTCCAACAACACGACCAACCAGGCCACCACCTCCCCTCATCCCATCATCTAAAACCACAGTGGCATCAGAAAAA

CCATCCTTTATAATGGGAGGGTCTATCTCACAG - UNI27108 - GGAACTCCTGGCACTTACTTGTCTTCTCATAATCAGGCTTATCCACAAGAAGC

CCCTAAGCCCTCCGTGGGGTCTATCTCTCTGGGATTGCCCCGGCAGCAGGAGTCTACCAAAGCAG - UNI26134 - CTCCTTTGACCTACATCAAGC

AGGAAGAATTTTCTCCGAGAAGCCAAAACTCACAACCTGAGGGTTTATTGGTCAGAGCGCAGCATGAAGGTGTGGTCAGAG - UNI20028 - GCACT

GCAGGGGCTGTCCAAGAAGGAAGTATAACTCGGGGAACTCCAGCCAGCAAAATCTCAGTGGAGACCATTTCATCGTTGCGGGGCTCTATTACCCAG - U

NI20330 - GGGACCCCAGCTCTGCCCCAGGCTGGAATACCAACAGAGGCTTTGGTGAAGGGACCTGTCTCCAGGATGCCTATTGAAGAAAGCAGTCCT

GAGAAGGTCAGAGAGGAAGCTGCATCCAAGGGCCATGTTATCTATGAAGGCAAAAGTGGACATATCTTATCATATGATA - UNI12079 - - UNI20

330 - ATATTAAGAATGCCCGAGAAGGGACTCGGAGTCCAAGAACAGCTCATGAAATGAGTTTAAAAAGAAGCTATGAGGCAGTGGAAGGAAGTATAAA

GCAAGGCATGTCGATGAGGGAGTCTCCTGTGTCAGCACCTTTAGAGG - UNI22523 - GTCTGATATGCCGAGCATTACCCAGGGGGAGCCCTCATT

CTGACCTCAAAGAGAGGACTGTGCTGTCTGGTTCCATAATGCAGG GCACACCAAGAGCCACAGCGGAAAGCTTTGAGGACGGCCTTAAATACCCCAAAC

AGATAAAAAGGGAGAGCCCTCCCATCCGAGCATTTGAAGGTGCCATTACCAAAGGAAAACCATACGATGGTATCACCACCATCAAAGAAATGGGGCGCTC

CATCCATGAAATCCCACGGCAAGATATTCTAACTCAGGAAAGCCGGAAAACTCCAGAAGTGGTCCAGAGCACGAGGCCAATAATTGAGGGTTCCATTTCC

CAG - UNI7679 - GGCACACCAATAAAATTTGACAACAACTCAGGTCAATCAGCTATCAAACACAATGTGAAGTCCTTAATCACAGGGCCTAGCAAA

CTACCCCGTGGAATGCTGGAAATTGTACCAGAGAACATAAAAGTAGTAGAACGGGGAAAATATGAGGATGTGAAAGCAGGCGAGCCAGTGCGAGCCCGGC

ACACGTCAGTGGTGAGCTCTGGCCCCTCCGTTCTCAGGTCTACACTTCACGAAGCTCCCAAAGCACAGCTGAGCCCGGGACTCTATGATGACAGCAGCGC

TCGCAGGACTCCTGTGAGCTACCAGAACACCATATCCAGAGGCTCCCCCATGATGAACAGAACTTCTGATG TTTCTTCCAGCAAGTCTGCCAGTCATGA

AAGGAAATCAACTCTGACCCCAACCCAAAGAGAAAGTATACCAGCCAAGTCTCCAGTGCCCGGGGTGGATCCCGTCGTGAGTCACAGCCCATTTGATCCT

CATCACAGGAGTAGCGCTGCAGGAGAGGTTTATCGGAGCCACCTACCCACGCACTTGGATCCAGCTATGCCCTTTCACAGGGCTTTGGATCCTG - UNI

290 - - UNI29379 - CTGCTGCTTACCTGTTACAGAGACAGCTTTCACCAACCCCAGGATACCCAAGTCAGTACCAGCTCTATGCAATGGAGAATA

CAAGGCAGACAATCCTCAACGATTACATTACCTCACAGCAGATGCAGGTGAATCTGCGCCCTGATGTCACCAGGGGACTGTCCCCACGAGAGCAGCCACT

GGGGCTCCCTTACCCAGCTACAAGAG GAATCATTGACCTGACCAATATGCCTCCAACAATCTTAGTGCCTCATGCAGGGGGAACGAGCACCCCTCCCAT

GGACAGGATCACGTATATTCCTGGTACACAGGTTACTTTCCCTCCCAGGCCATATAACGCTGCTTCTCTGTCTCCAG GACACCCAACACACCTTGCAGC

AGCTGCAAGTGCTGAGAGGGAACGAGAGCGGGAAAGGGAGAAGGAGCGCGAACGTGAGCGCGAGCGTGAGCGTGAACGTGAACGCGAAAGGATCGCTGCT

GCTCCCGCTGACCTCTACCTACGACCAG GTTCAGAACAGCCAGGCCGTCCTGGCAGCCACGGATATGTTCGCTCCCCTTCCCCTTCAGTAAGAACTCAG

GAGACCATCCTGCAACAGAGACCCAGTGTTTTCCAGGGCACCAATGGAACCAGTGTAATCACACCTTTGGACCCAACTGCTCAGCTACGCATCAT GCCA

CTGCCTTCTGGGGGCCCTTCCATAAGTCAAGGCCTGCCAGCCTCCCGTTACAACACTGCTGCGGATGCCCTGGCTGCTCTTGTGGATGCTGCAGCTTCTG

CACCCCAGATGGATGTTTCCAAAACAAAAGAGAGTAAGCATGAAGCTGCCAGGTTAGAAGAAAATTTGAGAAGCAGGTCAGCAGCAGTTAGTGAACAGCA

GCAGCTAGAGCAGAAAAACCTGGAGGTGGAGAAGAGATCTGTTCAGTGTGTGTGCACTTCTTCAGCCCTTCCAAGTGGCAAGGCCCAGCCTCATGCCTCA

GTAGTGTATTCTGAGGCTGGGAAAGATAAAGGGCCTCCTCCAAAATCCAGATATGAGGAAGAGCTAAGGACCCGAGGGAAGACTACCATTACTGCAGCTA

ACTTCATAGACGTGATCATCACCCGGCAAATTGCCTCGGACAAGGATGCGAGGGAACGTGGCTCTCAAAGTTCAGACTCTTCTAGTAGCT - UNI2493

 - TGTCTTCTCACAGGTATGAAACGGCTAGTGATGCCATTGAGGTGATAAGTCCCGCCAGCTCACCTGCACCACCCCAGGAAAAGCCACAGGCCTATCA

GCCAGACATGGTTAAGGCAAATCAAGCAGAAA ATGAGTCCACTCGACAGTATGAAGGTCCACTGCATCATTATCGGTCCCAGCAGGAATCACCATCTCC

ACAGCAACAGCCACCACTGCCCCCATCTTCCCAGTCAGAGGGAATGGGACAGGTGCCCAGGACCCATCGACTGATCACACTTGCTGACCACATCTGT CA

AATTATCACACAAGATTTTGCTAGAAATCAAGTTCCCTCGCAGCCTTCTACTTCTACATTCCAAACTTCACCATCTGCTTTGTCATCCACACCTGTAAGA

ACTAAAACCTCAAGCCGCTACAGCCCAGAATCACAGTCTCAGACTGTCTTGCATCCCAGACCAGGTCCTAGAGTCTCTCCAGAAAATCTTGTGGATAAAT

CCCGGGGAAG CAGGCCTGGAAAATCTCCAGAGAGGAGTCATATCCCATCAGAGCCCTATGAGCCCATCTCCCCACCCCAAGGCCCTGCTGTGCATGAGA

AGCAGGACAGCATGTTGCTCTTGTCACAGAGGGGAGTGGACCCTGCTGAGCAAAG - UNI5550 - GAGTGATTCTCGATCACCAGGAAGTATAAGCT

ACTTGCCTTCATTCTTCACCAAGCTTGAAAGCACATCACCCATGGTTAAATCAAAGAAACAGGAAATTTTTCGTAAGTTGAACTCTTCTGGTGGAGGTGA

CTCTGATATGG - UNI5550 - CAGCTGCTCAGCCAGGAACAGAGATCTTCAATCTGCCAGCAGTTACCACATCAG GTGCAGTGAGCTCAAGAAGCC

ATTCTTTTGCTGATCCCGCCAGTAACCTTGGTCTAGAAGACATCATCAGAAAGGCTCTCATGGGAAGTTTTGATGATAAAGTTGAAGATCATGGTGTTGT

CATGTCCCATCCTGTGGGCATTATGCCTGGTAGTGCCAGCACCTCAGTGGTGACGAGCAGCGAGGCACGGAGAGATGAAGGGGAGCCATCACCTCATGCA

G GAGTATGCAAACCAAAGCTGATCAACAAATCAAACAGCAGGAAGTCTAAATCTCCTATTCCTGGGCAAAGCTATTTAGGAACTGAAAGGCCTTCTTCT

GTCTCCTCTGTGCATTCAGAAGGTGATTACCACAGGCAGACACCAGGATGGGCATGGGAAGATCGGCCCTCTTCAACAG - UNI160 - - UNI2779

8 - GTTCTACTCAGTTCCCTTACAACCCTCTGACCATACGGATGCTCAGCAGTACACCACCTACACAGATCGCATGCGCCCCATCTGCCATCACCCAAG

CAGCTCCACATCAACAGAACCGCATCTGGGAGAGGGAGCCTGCCCCGCTCCTCTCAGCGCAGTATGAGACACTGTCTGATAGTGACGACTGAGCTGTGCG

TGGGAGAGCGCTCTGGCTTTGGTTTTTATTGAAGATTTAAAAAAAAAAAAAGAAAATTATTCTGCCCTCCCATGATTTGTGCCCAGAGACTTCTCAGGAG

AGCCAGGGCCATGGATGAGGAAGAAATGATGGAAATTCATTTGGAAAATCAAATGGGAAAAAACAAACAAAAAAACTGCCTCTAATACAGGCACTTCAAT

GGATTATAACAGTGGCGGGTTGAAGTGTAGAGTTTTTTTAAAGTGGACAATTCTTGTTCTTACATCTGTTTGTAAAGAAAACCATGATGTCTTTAAATCA

ATCTTCTGTAAATAGATGACTTTTTTGCAGTGTATCCCCTTGCTGTAGTATCTGGTGTACTTAAATTTAAATCAGCGAATCAACTGGGGAGAATTTTTAA

AATTCTTTGTGTATCTTTTTAACCCCAGCCTCTAAACCTCACACAGCCCAGTTCCACAGTGCTGGCTGTCATGGGCATTGTACTTTTGTTTCCTCTAAAT

TCAGCTTTCCCAGTGATGTTTAAATCTTGTGGAAATATTTAGGTTTTTAACACATACCCTGTCATAAAGCCTGTATGAGGTCAGAAGACAGGAGCAACAC

AACTGTCATATTGTGAGTTCCAGTGCAGGCTTGGCTTTCATTGGTAGCACTGAAAAAAATTACTGCATGGGTATGTTATAGTTCAGTTTTAAAGTTTAAA

GGCTTTTTTGAGGCATACCTCAATGTTTATGCACACTGGTAATTTAACCACGCCCCCTAAGTATTCTGCATTTGATGCAGCCCAACAAAGCTTCTTTCTG

TTCTGAAATAAATTTTGACTATCCTGTCCATAGCTACAGTACATCATTTGTGACGTAAAGAGTCTTCGTTTCTCAGGTTTCAAACAATTAGTATACATGC

TTTTCTTTAGATACAGAATTGGCGGAGTTAAAAAGAGAACACTGTATAGAACTTTCTGTCTTCCAGGCTTGTTTTTATGCTGCATCGTGAACTGACCGTT

GAGCACAGTCCTCTGCATCAGTGCCCATTCTCTGCTCCTAGGGAACAGATTCTTAAGGTGCAAGTAATTTAAAGACTGAATTTTAAACTAATTATGGCAC

TGTAGGATCACCTTTATTCATTAAGAATTGCTTGCTGTGATTCAG
Translation
 - UNI468 - - UNI3377 - MSSSGYPPNQGAFSTEQSRYPSHSVQYTFPSTRHQQ - UNI3377 - - UNI14267 - - UNI17971 - E

FAVPDYRSSHIEVSQASQLLQQQQQQQQLRRRPSLLSEFHPGSDR - UNI2063 - - UNI10810 - - UNI14267 - - UNI14658 - - U

NI17971 - RPQERRTGYEQFHSGPSPVDHDSLESKRPRLEPVSDAHFQRVSAAVLPLVHSLPEGLRSSADAKK - UNI4769 - - UNI10810 -

 - UNI14658 - DSAFGSKHEAPSSPLAGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQ - UNI4769 - - UNI14658 -

 - UNI18571 - QQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENR - UNI4983 - - UNI16829 - KKAEEAHKIFEGLGPKVEL - 

UNI4983 - PLYNQPSDTKVYHENIKT - UNI27659 - TNQVMRKKLILFFKRRNHARKQR EQKICQRYDQLMEAWEKKVDRIENNPRRKAKESK

TREYYEKQFPEIRKQREQQERFQR - UNI17360 - RVGQRGAGLSATIARSEHEISEIIDGLSEQE - UNI27605 - NNEKQMRQLSVIPPMMF

DAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDK - UNI27605 - KFIQHPKNFGLIASYLERK - UNI4061 - - UNI28761 

- - UNI32153 - SVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQ - UNI4061 - - UNI18956 - - UNI32153 - QIARPSQEEKVE

EKEEDKAEKTEKKEEEKKDDEEKDDKEDSK - UNI18956 - - UNI32153 - KETTKEKDRTEATAEEPEEREQVTPRGRKTANSQGRRKGRVTR

SMTSEAAAANAAAAATEEPPPPLPPPPEPI - UNI6689 - ISTEPVETSRWTEEEMEVAKKG - UNI6689 - GLVEHGRNWAAIAKMVGTKSEA

QCKNFYFNYKRRHNLDNLLQQHKQK ASRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEG GAENSSDTESAPSPSPVEAAKSSEDSSENA

ASRGNTEPVAELEATTDPAPCASPSSAVPTTKPAERESVEAQVTDSASAETAEPMDVDHEECGAEGSSVLDPPAPTKADSVDPEMQVPENTASKGEGDAK

ERDLESTSEKTEARDEDVVVAEQIERPEPQSDDDSSATCSADEGVDGEPERQR RVFPMDAKPSLLTPPGSILISSPIKPNPLDLPQLQHRAAVIPPM -

 UNI9235 - VSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQVDLECRSSTSPCSTSKSPNREWEV - UNI9235 - VLQPAPHQVI

TNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQ - UNI27108 - GTPGTYLSSHNQAYPQEAPKPSVGSISLGLPRQQESTKAA -

 UNI26134 - APLTYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRG - UNI20028 - GTAGAVQEGSITRGTPASKISVETISSLRGSITQ - UN

I20330 - GTPALPQAGIPTEALVKGPVSRMPIEESSPEKVREEAASKGHVIYEGKSGHILSYDN - UNI12079 - - UNI20330 - NIKNARE

GTRSPRTAHEMSLKRSYEAVEGSIKQGMSMRESPVSAPLEG - UNI22523 - GLICRALPRGSPHSDLKERTVLSGSIMQG GTPRATAESFEDGLK

YPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQ - UNI7679 - GTPIKFDNNSGQSAIK

HNVKSLITGPSKLPRGMLEIVPENIKVVERGKYEDVKAGEPVRARHTSVVSSGPSVLRSTLHEAPKAQLSPGLYDDSSARRTPVSYQNTISRGSPMMNRT

SDV VSSSKSASHERKSTLTPTQRESIPAKSPVPGVDPVVSHSPFDPHHRSSAAGEVYRSHLPTHLDPAMPFHRALDPA - UNI290 - - UNI2937

9 - AAAYLLQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVTRGLSPREQPLGLPYPATRG GIIDLTNMPPTILVPHAGGTSTPPM

DRITYIPGTQVTFPPRPYNAASLSPG GHPTHLAAAASAEREREREREKERERERERERERERERIAAAPADLYLRPG GSEQPGRPGSHGYVRSPSPSV

RTQETILQQRPSVFQGTNGTSVITPLDPTAQLRIM MPLPSGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAA

VSEQQQLEQKNLEVEKRSVQCVCTSSALPSGKAQPHASVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSS

SL - UNI2493 - LSSHRYETASDAIEVISPASSPAPPQEKPQAYQPDMVKANQAEN NESTRQYEGPLHHYRSQQESPSPQQQPPLPPSSQSEGMGQ

VPRTHRLITLADHIC QIITQDFARNQVPSQPSTSTFQTSPSALSSTPVRTKTSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGS SRPGKSPERSHI

PSEPYEPISPPQGPAVHEKQDSMLLLSQRGVDPAEQR - UNI5550 - RSDSRSPGSISYLPSFFTKLESTSPMVKSKKQEIFRKLNSSGGGDSDMA 

- UNI5550 - AAAQPGTEIFNLPAVTTSG GAVSSRSHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSHPVGIMPGSASTSVVTSSEARRDEG

EPSPHAG GVCKPKLINKSNSRKSKSPIPGQSYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTG - UNI160 - - UNI27798 - GSTQFPY

NPLTIRMLSSTPPTQIACAPSAITQAAPHQQNRIWEREPAPLLSAQYETLSDSDD

For any suggestions or comments, please send an email to unitrap@crg.es