Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000018537 (Pcgf2)
Chromosomal location
Chr 11: 97551106 - 97561660 (-)
Description
polycomb group ring finger 2 Gene [Source:MGI (curated);Acc:Pcgf2-001]
RefSeq_dna
NM_009545 
RefSeq_peptide
NP_033571.1 
MGI
MGI:99161 
Uniprot/SWISSPROT
P23798 
Uniprot/SPTREMBL
B1AR02 B1AR14 
Human Ortholog
ENSG00000056661 (PCGF2)
Omim not available
UniTrap UNI31296
Vector Insertion
Chr 11: 97560849 - 97561661
Public Clones IST14645D1 (tigm) IST13804A10 (tigm) IST11689D11 (tigm) IST13773G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI424
Vector Insertion
Chr 11: 97559375 - 97560519
Public Clones XT0182 (sanger) PST18167-NR (escells) IST10301E4 (tigm)
Private Clones OST52926 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17665
Vector Insertion
Chr 11: 97554729 - 97554883
Public Clones not available
Private Clones OST438598 (lexicon) OST368266 (lexicon) OST302779 (lexicon) OST288840 (lexicon)
OST259271 (lexicon) OST250653 (lexicon) OST200706 (lexicon) OST188553 (lexicon)
OST115536 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31724
Vector Insertion
Chr 11: 97554729 - 97559375
Public Clones IST14255D12 (tigm) IST11570D11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24119
Vector Insertion
Chr 11: 97553450 - 97553682
Public Clones not available
Private Clones OST234010 (lexicon) OST216212 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22367
Vector Insertion
Chr 11: 97553340 - 97553450
Public Clones not available
Private Clones OST299166 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000018681
Sequence
GCGTTCCATTCTTCTCCGCCCGAGCACGCTGAGCGCGCCAGCCTCGGCCACAGCCAAGCCCCGAGGCCACCGTGCGTTTCCCGCGAG - UNI31296 -

 GTTTCTCCCCTCCCGCCGACCGAGCGAGCGACAGGGCTGTGGTCCCCCTCCCCTCCCTTCCCTCCCTCCCTCCCATCCCCCCCTCCCCGAGACCCACCG

GACCCCGAAGCCAG - UNI31296 - ATGGCCGAAGTGGATTCCCCCTCTTAACGATTTGGAGTCTCCCTCGACCACCTCCTCTTTGTGCAGCAGCCC

CCTGCTAAGACCCTGCTTGCGAG - UNI424 - - UNI31724 - GCAGGAAACAGCCTCCAGGATCCAGTCCGGCTGTCGCGTCGCCTGATCCTGT

TCAAGTTGAAGGCTTGGGAG - UNI17665 - - UNI31724 - GGTGACACTTCCCAAATCTCCTCAGTCCTGACCCCGGCATCATGCATCGGACC

ACACGGATTAAAATCACGGAGCTGAACCCTCACCTCATGTGTGCCCTCTGTGGGGGCTATTTTATTGATGCCACCACCATTGTGGAATGCTTACATTCCT

 - UNI17665 - - UNI31724 - TCTGCAAAACCTGCATCGTACGCTACTTGGAGACCAACAAATACTGCCCCATGTGTGACGTCCAGGTCCATAA

AACTCGACCACTGCTGAGCATCAG ATCAGACAAAACCCTCCAGGACATTGTCTACAAGTTGGTGCCTGGGCTTTTTAAAG ATGAAATGAAACGGCGAC

GGGACTTCTATGCAGCATACCCCCTGACAGAGG - UNI22367 - - UNI24119 - TCCCCAACGGCTCCAACGAGGACCGAGGCGAGGTCCTGGA

ACAGGAGAAGGGGGCTCTGGGTGACGACGAGATTGTCAGTCTTTCCATTGAGTTCTACGAAGGCGTCAG - UNI22367 - GGACCGAGAGGAGAAGA

AGAACCTCACGGAGAATGGAGATGGGGACAAGGAGAAG ACAGGAGTGCGATTCCTGCGGTGCCCAGCAGCCATGACCGTCATGCACCTGGCAAAGTTCC

TCCGCAACAAAATGGATGTGCCCAGCAAGTACAAG GTGGAGATCCTCTATGAAGATGAGCCCCTGAAGGAATACTACACCTTAATGGACATTGCGTACA

TCTACCCCTGGCGAAGG AATGGGCCTCTCCCCCTCAAGTACCGTGTCCAGCCAGCCTGCAAGCGGCTCACCCTGCCCACGGTGCCAACCCCCTCAGAAG

GCACCAACACCAGCGGGGCATCAGAGTGTGAGTCAGTCAGCGACAAGGCTCCCAGCCCTGCCACCCTTCCGGCCACCTCCTCCTCCTTGCCCAGCCCTGC

GACCCCATCCCATGGCTCTCCCAGCTCCCACGGCCCCCCAGCTACCCATCCTACTTCCCCCACTCCACCTTCAACTGCCGCTGGGACCACCACAGCTACC

AATGGGGGCACTTCGAACTGCCTGCAAACGCCATCCTCCACCAGCAGGGGGCGCAAGATGACTGTTAATGGCGCTCCTTGCCCCCCTTGAGGAAAGGGAC

CCTCTCCTTCCGCAGCCATCTTTTCCCTCCTTTTTACTTTTTCTGGGCCCCCTTTTCCACTTTTGACTTTCCCTGGTTCCTCCCATTTTCAGAGTGGGAG

GTGGGTTTTATAAATAAATCTATATATATATAAATATATATATGTACATAGG
Translation
 - UNI31296 -  - UNI31296 -  - UNI424 - - UNI31724 -  - UNI17665 - - UNI31724 - MHRTTRIKITELNPHLMCAL

CGGYFIDATTIVECLHSF - UNI17665 - - UNI31724 - FCKTCIVRYLETNKYCPMCDVQVHKTRPLLSIR RSDKTLQDIVYKLVPGLFKD 

DEMKRRRDFYAAYPLTEV - UNI22367 - - UNI24119 - VPNGSNEDRGEVLEQEKGALGDDEIVSLSIEFYEGVR - UNI22367 - RDRE

EKKNLTENGDGDKEK TGVRFLRCPAAMTVMHLAKFLRNKMDVPSKYK VEILYEDEPLKEYYTLMDIAYIYPWRR NGPLPLKYRVQPACKRLTLPTVP

TPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPATPSHGSPSSHGPPATHPTSPTPPSTAAGTTTATNGGTSNCLQTPSSTSRGRKMTVNGAPCPP

Transcript ENSMUST00000103148
Sequence
CCCTCCCGCCGACCGAGCGAGCGACAGGGCTGTGGTCCCCCTCCCCTCCCTTCCCTCCCTCCCTCCCATCCCCCCCTCCCCGAGACCCACCGGACCCCGA

AGCCAG - UNI31296 - ATGGCCGAAGTGGATTCCCCCTCTTAACGATTTGGAGTCTCCCTCGACCACCTCCTCTTTGTGCAGCAGCCCCCTGCTAA

GACCCTGCTTGCGAG - UNI424 - - UNI17665 - - UNI31724 - GGTGACACTTCCCAAATCTCCTCAGTCCTGACCCCGGCATCATGCAT

CGGACCACACGGATTAAAATCACGGAGCTGAACCCTCACCTCATGTGTGCCCTCTGTGGGGGCTATTTTATTGATGCCACCACCATTGTGGAATGCTTAC

ATTCCT - UNI17665 - - UNI31724 - TCTGCAAAACCTGCATCGTACGCTACTTGGAGACCAACAAATACTGCCCCATGTGTGACGTCCAGGT

CCATAAAACTCGACCACTGCTGAGCATCAG ATCAGACAAAACCCTCCAGGACATTGTCTACAAGTTGGTGCCTGGGCTTTTTAAAG ATGAAATGAAAC

GGCGACGGGACTTCTATGCAGCATACCCCCTGACAGAGG - UNI22367 - - UNI24119 - TCCCCAACGGCTCCAACGAGGACCGAGGCGAGGT

CCTGGAACAGGAGAAGGGGGCTCTGGGTGACGACGAGATTGTCAGTCTTTCCATTGAGTTCTACGAAGGCGTCAG - UNI22367 - GGACCGAGAGG

AGAAGAAGAACCTCACGGAGAATGGAGATGGGGACAAGGAGAAG ACAGGAGTGCGATTCCTGCGGTGCCCAGCAGCCATGACCGTCATGCACCTGGCAA

AGTTCCTCCGCAACAAAATGGATGTGCCCAGCAAGTACAAG GTGGAGATCCTCTATGAAGATGAGCCCCTGAAGGAATACTACACCTTAATGGACATTG

CGTACATCTACCCCTGGCGAAGG AATGGGCCTCTCCCCCTCAAGTACCGTGTCCAGCCAGCCTGCAAGCGGCTCACCCTGCCCACGGTGCCAACCCCCT

CAGAAGGCACCAACACCAGCGGGGCATCAGAGTGTGAGTCAGTCAGCGACAAGGCTCCCAGCCCTGCCACCCTTCCGGCCACCTCCTCCTCCTTGCCCAG

CCCTGCGACCCCATCCCATGGCTCTCCCAGCTCCCACGGCCCCCCAGCTACCCATCCTACTTCCCCCACTCCACCTTCAACTGCCGCTGGGACCACCACA

GCTACCAATGGGGGCACTTCGAACTGCCTGCAAACGCCATCCTCCACCAGCAGGGGGCGCAAGATGACTGTTAATGGCGCTCCTTGCCCCCCTTGAGGAA

AGGGACCCTCTCCTTCCGCAGCCATCTTTTCCCTCCTTTTTACTTTTTCTGGGCCCCCTTTTCCACTTTTGACTTTCCCTGGTTCCTCCCATTTTCAGAG

TGGGAGGTGGGTTTTATAAATAAATCTATATATATATAAATATATATATGTACATAGGAAAAA
Translation
 - UNI31296 -  - UNI424 - - UNI17665 - - UNI31724 - MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSF - UNI1766

5 - - UNI31724 - FCKTCIVRYLETNKYCPMCDVQVHKTRPLLSIR RSDKTLQDIVYKLVPGLFKD DEMKRRRDFYAAYPLTEV - UNI2236

7 - - UNI24119 - VPNGSNEDRGEVLEQEKGALGDDEIVSLSIEFYEGVR - UNI22367 - RDREEKKNLTENGDGDKEK TGVRFLRCPAAM

TVMHLAKFLRNKMDVPSKYK VEILYEDEPLKEYYTLMDIAYIYPWRR NGPLPLKYRVQPACKRLTLPTVPTPSEGTNTSGASECESVSDKAPSPATLP

ATSSSLPSPATPSHGSPSSHGPPATHPTSPTPPSTAAGTTTATNGGTSNCLQTPSSTSRGRKMTVNGAPCPP
Transcript ENSMUST00000103149
Sequence
GGCGACGGGACTTCTATGCAGCATACCCCCTGACAGAGG - UNI22367 - - UNI24119 - TCCCCAACGGCTCCAACGAGGACCGAGGCGAGGT

CCTGGAACAGGAGAAGGGGGCTCTGGGTGACGACGAGATTGTCAGTCTTTCCATTGA - UNI22367 - TTCCTCCGCAACAAAATGGATGTGCCCAG

CAAGTACAAG GTGGAGATCCTCTATGAAGATGAGCCCCTGAAGGAATACTACACCTTAATGGACATTGCGTACATCTACCCCTGGCGAAGG AATGGGC

CTCTCCCCCTCAAGTACCGTGTCCAGCCAGCCTGCAAGCGGCTCACCCTGCCCACGGTGCCAACCCCCTCAGAAGGCACCAACACCAGCGGGGCATCAGA

GTGTGAGTCAGTCAGCGACAAGGCTCCCAGCCCTGCCACCCTTCCGGCCACCTCCTCCTCCTTGCCCAGCCCTGCGACCCCATCCCATGGCTCTCCCAGC

TCCCACGGCCCCCCAGCTACCCATCCTACTTCCCCCACTCCACCTTCAACTGCCGCTGGGACCACCACAGCTACCAATGGGGGCACTTCGAACTGCCTGC

AAACGCCATCCTCCACCAGCAGGGGGCGCAAGATGACTGTTAATGGCGCTCCTTGCCCCCCTTGAGGAAAGGGACCCTCTCCTTCCGCAGCCATCTTTTC

CCTCCTTTTTACTTTTTCTGGGCCCCCTTTTCCACTTTTGACTTTCCCTGGTTCCTCCCATTTTCAGAGTGGGAGGTGGGTTTTATAAATAAATCTATAT

ATATATAAATATATATATGTACATAGGAAAAACCAAATATACATACTTATTTTCTATGGA
Translation
 - UNI22367 - - UNI24119 -  - UNI22367 - MDVPSKYK VEILYEDEPLKEYYTLMDIAYIYPWRR NGPLPLKYRVQPACKRLTLPTV

PTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPATPSHGSPSSHGPPATHPTSPTPPSTAAGTTTATNGGTSNCLQTPSSTSRGRKMTVNGAPCP

P

For any suggestions or comments, please send an email to unitrap@crg.es