Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000018583 (G3bp1)
Chromosomal location
Chr 11: 55283187 - 55314013 (+)
Description
Ras-GTPase-activating protein SH3-domain binding protein 1 Gene [Source:MGI (curated);Acc:G3bp1-001]
RefSeq_dna
NM_013716 
RefSeq_peptide
NP_038744.1 
UniGene
Mm.380129 
MGI
MGI:1351465 
Uniprot/SWISSPROT
P97855 
Uniprot/SPTREMBL
Q3UR88 Q571F9 Q5NCU1 
Human Ortholog
ENSG00000145907 (G3BP1)
Omim not available
UniTrap UNI4710
Vector Insertion
Chr 11: 55283304 - 55299127
Public Clones XT0126 (sanger) (sanger) XG696 (baygenomics) BGB116 (baygenomics) XST022 (baygenomics)
YTB043 (baygenomics) RST155 (baygenomics) XST004 (baygenomics) RST517 (baygenomics)
BGA215 (baygenomics) XST019 (baygenomics) E028C04 (ggtc) P017G07 (ggtc)
P140E09 (ggtc) E028B04 (ggtc) A001A09 (ggtc) 5SP141C01 (ggtc) P017H07 (ggtc)
D138C05 (ggtc) PST8248-NL (escells) PST19069-NR (escells) IST14647C11 (tigm)
Private Clones OST232595 (lexicon) OST152927 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5070
Vector Insertion
Chr 11: 55299241 - 55300980
Public Clones YTC551 (baygenomics) BGA219 (baygenomics) A029A02 (ggtc)
Private Clones OST196982 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2662
Vector Insertion
Chr 11: 55301063 - 55302520
Public Clones AL0573 (sanger) AP0563 (sanger) RRJ304 (baygenomics) Ayu21-T244 (egtc)
IST14993C3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11560
Vector Insertion
Chr 11: 55307044 - 55308754
Public Clones P068C01 (ggtc) (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26103
Vector Insertion
Chr 11: 55308954 - 55309645
Public Clones PST25528-NR (escells)
Private Clones OST137494 (lexicon)
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37423
Vector Insertion
Chr 11: 55309748 - 55311152
Public Clones PST23499-NR (escells) PST20034-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12360
Vector Insertion
Chr 11: 55311265 - 55311414
Public Clones W054B02 (ggtc) CMHD-GT_486G6-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12103
Vector Insertion
Chr 11: 55311544 - 55312059
Public Clones A053F01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7662
Vector Insertion
Chr 11: 55312170 - 55312960
Public Clones RRS020 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000071288
Sequence
AGGTTCGGCTGAGCGCGGCTATATAGCGGGCGGCGGGCACGCGTGCCGCGGCATCGCGCGAGGGACGCCGCCACCTCCTCCCACGTAGCAGCCCTGTCCT

CCCGCTCAGCCGCGCAG - UNI4710 - GTTGAACCCACCAAAGCGATGGTTATGGAGAAGCCTAGTCCCCTGCTGGTCGGGCGGGAGTTTGTGCGAC

AGTACTACACTCTGCTGAACCAGGCCCCGGACATGTTGCACAG - UNI5070 - ATTTTATGGAAAGAACTCTTCCTATGCCCACGGGGGCTTGGATT

CCAACGGGAAGCCAGCAGATGCAGTCTACGGGCAGAAG - UNI2662 - GAAATCCACAGGAAAGTGATGTCACAAAACTTCACCAACTGCCACACCA

AGATCCGCCACGTGGATGCTCACGCAACTCTGAATGACGGGGTGGTGGTCCAAGTGATGGGGCTACTGTCCAACAACAACCAGGCTCTGCGGAGGTTCAT

GCAGACCTTTGTCCTTGCTCCTGAG GGCTCTGTTGCCAACAAATTCTATGTTCACAACGACATCTTCAGGTACCAAGATGAGGTCTTCGGTGGCTTTGT

CACAGAGCCTCAAGAGG AATCCGAGGAAGAAGTAGAAGAACCTGAAGAAAGACAGCAGACACCAGAGGTGGTGCCTGATGATTCTGGAACTTTCTATGA

TCAGACTGTCAG - UNI11560 - CAATGACTTGGAGGAGCATTTAGAGGAGCCTGTAGTGGAACCAGAACCGGAGCCAGAGCCGGAGCCGGAGCCGG

AACCTGTGTCCGACATTCAAGAGGACAAGCCTGAGGCTGCATTGGAAGAAGCTGCTCCCGACGATGTGCAGAAGAGCACTTCCCCGGCCCCGGCTGATGT

GGCCCCGGCACAGGAGGACTTGAGG - UNI26103 - ACGTTTTCTTGGGCATCTGTGACGAGTAAGAACCTTCCTCCCAGTGGGGCTGTTCCAGTGA

CGGGGACACCACCTCATGTGGTCAAAGTGCCAGCGTCACAG CCCCGTCCAGAATCTAAACCTGACTCTCAGATCCCACCACAAAGGCCTCAGAGAGATC

AGAGAGTTCGAGAGCAGCGAATCAATATCCCTCCTCAGAGAGGACCCCGACCAA - UNI12360 - TCCGTGAGGCTGGTGAACCAGGAGATGTGGAA

CCTCGAAGGATGGTGAGGCACCCTGACAGTCACCAGCTCTTCATTGGGAACCTGCCACATGAGGTTGACAAGTCGGAACTGAAGGATTTTTTCCAAA - 

UNI7662 - - UNI12103 - CCCATCATGTTCCGAGGCGCGGTCCGCCTGAATGTGGAAGAGAAGAAGACTCGAGCTGCCAGAGAAGGCGACCGCAG

GGATAACCGCCTTCGGGGACCTGGAGGCCCCCGTGGTGGGCCGAGTGGTGGGATGAGAGGCCCTCCCCGCGGAGGCATGGTGCAGAAACCAGGCTTTGGC

GTGGGCAGGGGGATTACAACTCCAAGGCAGTGAATTGCTTGGCTCTGATCTCCACACAGCACACAGCCCCGGCTCCTGCAGAATGGTGAATTCCTTTAAC

CAGCGTTTGGTGTCTCGGAATAGTCTATTATAAACTGCTTGAGTTTGTACAATTTTCATTTCGCTTGTGTTCATGGTGTGTGCTCCCAACCCCCTTTCCT

CCCCTGACCCCTTAGTCCTTCATTCCCAGTTTTCCGGAATGATACTTTAGGAGGAATAGATTGTAAAGAGGGAAGACTGACCTTCCTGCTCACGCTGCGT

ATACAGACTGGACTTTCACGGCCATTCCCCAGAGGAGCGCGTCTCGGCTTCACTGACAGCGGAGGTTTCGTTATTGGGAGACACAGGATTTGATAAACAT

TTTGGAAGCAGGAAAAATCAAGTCACGACTCCTTTCTGGTGTGGAAAAATTGCCTTTTGGCACCTGGCGCTGGGTCCCTGCTGGTGTGGCTAACTGAATA

AAAGGTGGTTGCAGACCTTTGTTCTTTTGACATGTGATTACCAAACAACTCTAAGCCTCCATTTTTACCATTGGATTTTAAATTGTGATGTAGCCTGTCA

ATGTCTAGAACACAGCTAAGGACTTTTGTTGACCTGTTAGAAATTTTTTTTTTTTTGAGGTAGAGTTTTTCATGTTTTATTTGTATTTGTAAAAAAAAGA

AAAAGAAAAAAAAAGAAAAAAGAAAAAAGGACAAAAAATTCCCACAAGAAAACAAACCCCCAAATCTGATAACAAAAACCAAGCAAAACTGTGCCTTCTA

TTTATCTTTGATTCCGGTCGGTCCTGGCAATTGTTTAAAGAAAAGTAATAAAGATTCTAGATTTGTTTTCAGATTC
Translation
 - UNI4710 - MVMEKPSPLLVGREFVRQYYTLLNQAPDMLHR - UNI5070 - RFYGKNSSYAHGGLDSNGKPADAVYGQK - UNI2662 - E

IHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPE GSVANKFYVHNDIFRYQDEVFGGFVTEPQEE ESEEEVEEPE

ERQQTPEVVPDDSGTFYDQTVS - UNI11560 - SNDLEEHLEEPVVEPEPEPEPEPEPEPVSDIQEDKPEAALEEAAPDDVQKSTSPAPADVAPAQE

DLR - UNI26103 - TFSWASVTSKNLPPSGAVPVTGTPPHVVKVPASQ PRPESKPDSQIPPQRPQRDQRVREQRINIPPQRGPRPI - UNI1236

0 - IREAGEPGDVEPRRMVRHPDSHQLFIGNLPHEVDKSELKDFFQT - UNI7662 - - UNI12103 - THHVPRRGPPECGREEDSSCQRRRPQ

G
Transcript ENSMUST00000018727
Sequence
AGGTTCGGCTGAGCGCGGCTATATAGCGGGCGGCGGGCACGCGTGCCGCGGCATCGCGCGAGGGACGCCGCCACCTCCTCCCACGTAGCAGCCCTGTCCT

CCCGCTCAGCCGCGCAG - UNI4710 - GTTGAACCCACCAAAGCGATGGTTATGGAGAAGCCTAGTCCCCTGCTGGTCGGGCGGGAGTTTGTGCGAC

AGTACTACACTCTGCTGAACCAGGCCCCGGACATGTTGCACAG - UNI5070 - ATTTTATGGAAAGAACTCTTCCTATGCCCACGGGGGCTTGGATT

CCAACGGGAAGCCAGCAGATGCAGTCTACGGGCAGAAG - UNI2662 - GAAATCCACAGGAAAGTGATGTCACAAAACTTCACCAACTGCCACACCA

AGATCCGCCACGTGGATGCTCACGCAACTCTGAATGACGGGGTGGTGGTCCAAGTGATGGGGCTACTGTCCAACAACAACCAGGCTCTGCGGAGGTTCAT

GCAGACCTTTGTCCTTGCTCCTGAG GGCTCTGTTGCCAACAAATTCTATGTTCACAACGACATCTTCAGGTACCAAGATGAGGTCTTCGGTGGCTTTGT

CACAGAGCCTCAAGAGG AATCCGAGGAAGAAGTAGAAGAACCTGAAGAAAGACAGCAGACACCAGAGGTGGTGCCTGATGATTCTGGAACTTTCTATGA

TCAGACTGTCAG - UNI11560 - CAATGACTTGGAGGAGCATTTAGAGGAGCCTGTAGTGGAACCAGAACCGGAGCCAGAGCCGGAGCCGGAGCCGG

AACCTGTGTCCGACATTCAAGAGGACAAGCCTGAGGCTGCATTGGAAGAAGCTGCTCCCGACGATGTGCAGAAGAGCACTTCCCCGGCCCCGGCTGATGT

GGCCCCGGCACAGGAGGACTTGAGG - UNI26103 - ACGTTTTCTTGGGCATCTGTGACGAGTAAGAACCTTCCTCCCAGTGGGGCTGTTCCAGTGA

CGGGGACACCACCTCATGTGGTCAAAGTGCCAGCGTCACAG CCCCGTCCAGAATCTAAACCTGACTCTCAGATCCCACCACAAAGGCCTCAGAGAGATC

AGAGAGTTCGAGAGCAGCGAATCAATATCCCTCCTCAGAGAGGACCCCGACCAA - UNI12360 - TCCGTGAGGCTGGTGAACCAGGAGATGTGGAA

CCTCGAAGGATGGTGAGGCACCCTGACAGTCACCAGCTCTTCATTGGGAACCTGCCACATGAGGTTGACAAGTCGGAACTGAAGGATTTTTTCCAAA - 

UNI12103 - ATTTTGGCAATGTGGTGGAGCTGCGCATCAACAGTGGTGGGAAGTTACCCAATTTCGGTTTTGTTGTGTTTGATGATTCTGAACCTGTT

CAGAAGGTCCTTAGTAATAGG - UNI7662 - CCCATCATGTTCCGAGGCGCGGTCCGCCTGAATGTGGAAGAGAAGAAGACTCGAGCTGCCAGAGAA

GGCGACCGCAGGGATAACCGCCTTCGGGGACCTGGAGGCCCCCGTGGTGGGCCGAGTGGTGGGATGAGAGGCCCTCCCCGCGGAGGCATGGTGCAGAAAC

CAGGCTTTGGCGTGGGCAGGGGGATTACAACTCCAAGGCAGTGAATTGCTTGGCTCTGATCTCCACACAGCACACAGCCCCGGCTCCTGCAGAATGGTGA

ATTCCTTTAACCAGCGTTTGGTGTCTCGGAATAGTCTATTATAAACTGCTTGAGTTTGTACAATTTTCATTTCGCTTGTGTTCATGGTGTGTGCTCCCAA

CCCCCTTTCCTCCCCTGACCCCTTAGTCCTTCATTCCCAGTTTTCCGGAATGATACTTTAGGAGGAATAGATTGTAAAGAGGGAAGACTGACCTTCCTGC

TCACGCTGCGTATACAGACTGGACTTTCACGGCCATTCCCCAGAGGAGCGCGTCTCGGCTTCACTGACAGCGGAGGTTTCGTTATTGGGAGACACAGGAT

TTGATAAACATTTTGGAAGCAGGAAAAATCAAGTCACGACTCCTTTCTGGTGTGGAAAAATTGCCTTTTGGCACCTGGCGCTGGGTCCCTGCTGGTGTGG

CTAACTGAATAAAAGGTGGTTGCAGACCTTTGTTCTTTTGACATGTGATTACCAAACAACTCTAAGCCTCCATTTTTACCATTGGATTTTAAATTGTGAT

GTAGCCTGTCAATGTCTAGAACACAGCTAAGGACTTTTGTTGACCTGTTAGAAATTTTTTTTTTTTTGAGGTAGAGTTTTTCATGTTTTATTTGTATTTG

TAAAAAAAAGAAAAAGAAAAAAAAAGAAAAAAGAAAAAAGGACAAAAAATTCCCACAAGAAAACAAACCCCCAAATCTGATAACAAAAACCAAGCAAAAC

TGTGCCTTCTATTTATCTTTGATTCCGGTCGGTCCTGGCAATTGTTTAAAGAAAAGTAATAAAGATTCTAGATTTGTTTTCAGATTC
Translation
 - UNI4710 - MVMEKPSPLLVGREFVRQYYTLLNQAPDMLHR - UNI5070 - RFYGKNSSYAHGGLDSNGKPADAVYGQK - UNI2662 - E

IHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPE GSVANKFYVHNDIFRYQDEVFGGFVTEPQEE ESEEEVEEPE

ERQQTPEVVPDDSGTFYDQTVS - UNI11560 - SNDLEEHLEEPVVEPEPEPEPEPEPEPVSDIQEDKPEAALEEAAPDDVQKSTSPAPADVAPAQE

DLR - UNI26103 - TFSWASVTSKNLPPSGAVPVTGTPPHVVKVPASQ PRPESKPDSQIPPQRPQRDQRVREQRINIPPQRGPRPI - UNI1236

0 - IREAGEPGDVEPRRMVRHPDSHQLFIGNLPHEVDKSELKDFFQN - UNI12103 - NFGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNR 

- UNI7662 - PIMFRGAVRLNVEEKKTRAAREGDRRDNRLRGPGGPRGGPSGGMRGPPRGGMVQKPGFGVGRGITTPRQ

For any suggestions or comments, please send an email to unitrap@crg.es