Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000018654 (Ikzf1)
Chromosomal location
Chr 11: 11585928 - 11672929 (+)
Description
IKAROS family zinc finger 1 Gene [Source:MGI (curated);Acc:Ikzf1-003]
RefSeq_dna
NM_009578 NM_001025597 
RefSeq_peptide
NP_033604.2 NP_001020768.1 
UniGene
Mm.103545 
MGI
MGI:1342540 
Uniprot/SWISSPROT
Q03267 
Uniprot/SPTREMBL
Q5GGW4 Q5SWT7 Q8C9X3 Q5SWU0 Q8C5P6 Q5GGW5 Q3UQ33 Q5SWT9 Q571F4 
Human Ortholog
ENSG00000185811 (IKZF1)
Omim not available
UniTrap UNI30191
Vector Insertion
Chr 11: 11661428 - 11668717
Public Clones D085C04 (ggtc) IST14728A4 (tigm) IST10223H10 (tigm) IST14052C2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000048122
Sequence
GAAAGAAAGCTGGGAATTGCTCCGCAGCCAACTTAGCAGGGCACTCTAACAAGTGCCTGCGCGGCCGCGCCCGGGCCGGGGACAGGGGCAGCCCGGCGCA

GTACAGCCCATCCCGGGACGCTCGGCCGCGGCTGCCGGAGACCCGGTAGGTCCCGCGGGGTGCAGGAGCCCCCAGATCCCCGGCTGCTCTTCGCGCCCCA

GGATCATTCTTGGCCCCCAAAGCGCGGCGCACAAATCCAC ATAACCTGAAGACAATGGATGTCGATGAGGGTCAAGACATGTCCCAAGTTTCAG GAAA

GGAGAGCCCCCCAGTCAGTGACACTCCAGATGAAGGGGATGAGCCCATGCCTGTCCCTGAGGACCTGTCCACTACCTCTGGAGCACAGCAGAACTCCAAG

AGTGATCGAGGCATGG GTGAACGGCCTTTCCAGTGCAACCAGTGTGGGGCCTCCTTTACCCAGAAAGGCAACCTCCTGCGGCACATCAAGCTGCACTCG

GGTGAGAAGCCCTTCAAATGCCATCTTTGCAACTATGCCTGCCGCCGGAGGGACGCCCTCACCGGCCACCTGAGGACGCACTCCG TTGGTAAGCCTCAC

AAATGTGGATATTGTGGCCGGAGCTATAAACAGCGAAGCTCTTTAGAGGAGCATAAAGAGCGATGCCACAACTACTTGGAAAGCATGGGCCTTCCGGGCA

TGTACCCAG TCATTAAGGAAGAAACTAACCACAACGAGATGGCAGAAGACCTGTGCAAGATAGGAGCAGAGAGGTCCCTTGTCCTGGACAGGCTGGCAA

GCAATGTCGCCAAACGTAAGAGCTCTATGCCTCAGAAATTTCTTGGTAAGAGTTAAATGTTTGCTGTCTCTTAACCTAGAATTATGTGGGTGTTCTAGAC

AAAAATTATTTGAAAG
Translation
 MDVDEGQDMSQVSG GKESPPVSDTPDEGDEPMPVPEDLSTTSGAQQNSKSDRGMG GERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYAC

RRRDALTGHLRTHSV VGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPGMYPV VIKEETNHNEMAEDLCKIGAERSLVLDRLASNVAKRKSSMP

QKFLGKS
Transcript ENSMUST00000018798
Sequence
TTGAGGAAGTCATTGTGAAAGAAAGCTGGGAATTGCTCCGCAGCCAACTTAGCAGGGCACTCTAACAAGTGCCTGCGCGGCCGCGCCCGGGCCGGGGACA

GGGGCAGCCCGGCGCAGTACAGCCCATCCCGGGACGCTCGGCCGCGGCTGCCGGAGACCCGGTAGGTCCCGCGGGGTGCAGGAGCCCCCAGATCCCCGGC

TGCTCTTCGCGCCCCAGGATCATTCTTGGCCCCCAAAGCGCGGCGCACAAATCCAC ATAACCTGAAGACAATGGATGTCGATGAGGGTCAAGACATGTC

CCAAGTTTCAG GAAAGGAGAGCCCCCCAGTCAGTGACACTCCAGATGAAGGGGATGAGCCCATGCCTGTCCCTGAGGACCTGTCCACTACCTCTGGAGC

ACAGCAGAACTCCAAGAGTGATCGAGGCATGG GTGAACGGCCTTTCCAGTGCAACCAGTGTGGGGCCTCCTTTACCCAGAAAGGCAACCTCCTGCGGCA

CATCAAGCTGCACTCGGGTGAGAAGCCCTTCAAATGCCATCTTTGCAACTATGCCTGCCGCCGGAGGGACGCCCTCACCGGCCACCTGAGGACGCACTCC

G TTGGTAAGCCTCACAAATGTGGATATTGTGGCCGGAGCTATAAACAGCGAAGCTCTTTAGAGGAGCATAAAGAGCGATGCCACAACTACTTGGAAAGC

ATGGGCCTTCCGGGCATGTACCCAG TCATTAAGGAAGAAACTAACCACAACGAGATGGCAGAAGACCTGTGCAAGATAGGAGCAGAGAGGTCCCTTGTC

CTGGACAGGCTGGCAAGCAATGTCGCCAAACGTAAGAGCTCTATGCCTCAGAAATTTCTTG - UNI30191 - GAGACAAGTGCCTGTCAGACATGCC

CTATGACAGTGCCAACTATGAGAAGGAGGATATGATGACATCCCACGTGATGGACCAGGCCATCAACAATGCCATCAACTACCTGGGGGCTGAGTCCCTG

CGCCCATTGGTGCAGACACCCCCCGGTAGCTCCGAGGTGGTGCCAGTCATCAGCTCCATGTACCAGCTGCACAAGCCCCCCTCAGATGGCCCCCCACGGT

CCAACCATTCAGCACAGGACGCCGTGGATAACTTGCTGCTGCTGTCCAAGGCCAAGTCTGTGTCATCGGAGCGAGAGGCCTCCCCGAGCAACAGCTGCCA

AGACTCCACAGATACAGAGAGCAACGCGGAGGAACAGCGCAGCGGCCTTATCTACCTAACCAACCACATCAACCCGCATGCACGCAATGGGCTGGCTCTC

AAGGAGGAGCAGCGCGCCTACGAGGTGCTGAGGGCGGCCTCAGAGAACTCGCAGGATGCCTTCCGTGTGGTCAGCACGAGTGGCGAGCAGCTGAAGGTGT

ACAAGTGCGAACACTGCCGCGTGCTCTTCCTGGATCACGTCATGTATACCATTCACATGGGCTGCCATGGCTTTCGGGATCCCTTTGAGTGTAACATGTG

TGGTTATCACAGCCAGGACAGGTACGAGTTCTCATCCCATATCACGCGGGGGGAGCATCGTTACCACCTGAGCTAAACCCAGCCAGGCCCCACTGAAGCA

CAAAGATAGCTGGTTATGCCTCCTTCCCGGCAGCTGGACCCACAGCGGACAATGTTGGGAGTGGATTTGCAGGCAGCATTTGTTCTTTTATGTTGGTTGT

TTGGCGTTTGATTTGCGTTGGAAGATAAGTTTTTAATGTTAGTGACAGGATTGCATTGCATCAGGAACATTCACAACATCCATCCTTCTAGCCAGTTTTG

TTCACTGGTAGCTGAGGTTTCCCGGATATGTGGCTTCCTAACACTCTCCCCACCCACCCCACCCCCCAAAACAGAGCCTGAATCTTCATGAAGTGAATAA

AACAATTATCCAAGAAGGAGTAAGGTGGATCTTGCCCTAAGCAGAGTTTATGCCACAAAGATTCTCCAAATCCCCCAAGACAGCACAGCCACTGGGGTTG

AGCCATCTCAGGGAGCTCTGCAGGTGAGCCAGAGGACCAGATATAAGGCAGCTGGGGAGGAGCAGGGACATCAGCCTGTGCAGAGACCAAGGCCAAAGGT

TGAACTTTGAAAGACTATTAAGTCATATATTGTATGGCAATATGGTGTCTGGACAAGTTGTGCAATGTGCTGAAGGGAAGGGATTGGAGAGCCTTGAAGA

CTCTTCTTCATTTGCCTGATCAACCCGACCTCCAGAGGGTTTGTTGCCCAGTAAGACGAGCTCAGTGCTCTTGTGATCATTTTTCTCTTATCGTTTCCAT

GCCGTTGATGGCCCTGAAGCTCATCACTGCATTTTAGAACCCAATCCTGAAATTGGGACCTTTTTTTTAAACTTCTGATACTGTAAAACTTCTTGGAAGC

CAAAGCTTTCTTCCAAGCCCCATCCTCAGTTATCCTGGTTCCTGTTCTTCCCCGAGCTGATAGTACCAGGACCTGTTATTCCACAAAAGCACAGGCATCC

GTCACTTCAATTCAATCCCTGTTCAGATTATAGATATGGACTTTGCTATCTTGATAAATGTCTTCTCTATGTTATTTTGTCTGAAAAACCTATAAAACCA

TTATTAAGAATGACCATTTTTAGATGGAAGAAATGAGCCCAGCATCTCAGTGGCTAAAACACAAAATATCCATGCTTTTAAACAAAATTGTTAAATATTC

CGAAGCTCTCTAGTATAAACACCAAGTAGCATGTGTTTTCACATAAAGAAGACAGGGGCCATGCAACCTTTATCAAGTGGAGGTATTAGAATGTTGTAAT

GTTTGGAGACACAGTGTGACCAGTACAGGTTCCCAGAGAGGAATGCCCACCATATCACAGAAAGGTAGAGGTGGGATCTGGTATAGCCAGACCAAGACAG

GGATGTCACGCTGAAGCCAAGTCAGTTAGCTGAAGATTCTCAACAGGAAGGCCTCTCTTAAGAGTCAGTAATAGGGTTGTTACCATCCACCACCTCAACA

AAACAAAAAGCTTATAATTGTAAATGTTTACAGCACTGTCTTCGCAGAAACTTTCTGAGGTGATTCCAAAGAACTAGAGGGGAGATGGTCTATAACAGCT

CTTGAAGTAAACGAGGTTCTTAGTCTCAGCTCTCCTGACATATAGGGCTTGATCATTACTGGTAGGGATTGTTCTGTGAATTGCTTACTACTACCCCTGG

TCTCTCCCCAGTAGATGCCAGGAACATTCTAGCTGATACCTAACTGTCTTCCCAGGTGTTCGAGGGAGCAAACCACTGATCTAAACTCTAAACGCTGAAG

TACGCAGGTTTTCTAAAAATGACAAGCCCTTGAAACCTTTCCCAGTAGGCAGCCTCGAGCTGGACTTGTGTCTTTGGAATGCTGATGAATTCTATAGATC

AGCATTGCAAATACACTTCAAATACGTCTGAGTTCAAGTGCAGGGACTGAGTTCACCAAGGTGTGAAATGTGCTCAAAAAGTTCAAAAGTGTGTGTTTCT

TTGTTTCTAAAACATTGTGGCATCTTTTTCATTTGTTTCTAAAACTTTTTTTTTAGAAACAAATGAAGCACTTGGAAAGTGAAAGTAAAATTACAAATAT

AAGGATTTACACTGAAGAGAGAAAAATTTTAGGAACTATAGCTGTGAAAAGATTTTGTTCAAAAGGCAGGCTAGCCTTACCCAAATTCATATATGGCAGG

TGTCAACCTCCCAAGCTTACAGTTAGCAGGCAGCTTTTGCTCACTCATCCTTAGCCATGAGAGCCATTAAGTGTGGTCCAAGAAAGATGGCTCCAAACCC

TACCCCCGACCCACCAGTGGTATTCAGAGATTAAAGCAGAATTGTAAATAGTGGCTTCAGGAGCTCTTTTTTAGAATGCTTTGCCCCTTCCTCTCACTGC

CTTTTTTAGCCAATATAAATGTCAATTTGCACACCTTTTGTTGTGGTTTTATATTGTAACAGCATTTTTTTGAAACTATTGTATTTAAGATAAGGTTTCA

TATTATGTCCACAAGTAATTAAATTATGTTTGAAGGTGGCTATATGCTGTATCAGAAGTTGATGATGTTTTTCTTTAGCTGGTAAAGGAGGGTTTTGCAT

GACCTCACTGTTTGTTCTGTGGTTTGTTCTGTTGTATGATGTGTGTCTTGAGTTTTGCTGTGTGATGAAGTGCGCTGAGATTCCAGTGCCCTCAAGTTGT

GTTTTAAGTAGCTATCAGAGGCAAGAGGGTTCCTAAGAGCAGGTTGACCTGTTGGCGACAGATGGCAATCACCATTTCTCATTCCTTCTTCTCCCTGTTA

CCCCAGCTTCCTGTCCCAGGTCCCTTCTGTGATTCTTACCTTAGTGTGCATGTGTGTCTGTCCTGGTGAGAGTCAGGAGCATCGATATGTTATCATTGCA

TTATCACCAAGGGCACGCACAGCCTAGCACCTGTTGCTTCAGATACCGTCACACTCTGTTTCCAATTTAGATACAACCACATAATAAAATGTTAGAGTCT

TCAATGGGAAGCAGAGGTGCTTGTTATAAAGATGGGGGCTTATGCTTGTGTCACATTTTGTGTTCTTTTCTTCTTTTGTTTGGTTTTAACTTAATTGTGA

CCCTTGTAACATCATCTTGCCAAAAAAAAAAAAAAAGTTGAACTGGATTTATGTAGACATGTCAAGACGTACTATCTATTTCTTTGTCAGTTATAGCAAT

AAGAGTGGATAAACTCTAAAATCCAGATCTCCCACAATGAACATCCGTGTTCTTTCTATGATTTTTCTTTCTTTATGGTGAGCCACAATTAAACTTGAGA

TGTACAGCCACCCAAACCCAGGAAGCTCATGTGCATCTGGTGCTATGGCACTCACTGTGAATAAGTGTGACCAGATATTAATATGCAATATTGTTTCCAA

TCCTTTCTAATACATTTTTTC
Translation
 MDVDEGQDMSQVSG GKESPPVSDTPDEGDEPMPVPEDLSTTSGAQQNSKSDRGMG GERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYAC

RRRDALTGHLRTHSV VGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPGMYPV VIKEETNHNEMAEDLCKIGAERSLVLDRLASNVAKRKSSMP

QKFLG - UNI30191 - GDKCLSDMPYDSANYEKEDMMTSHVMDQAINNAINYLGAESLRPLVQTPPGSSEVVPVISSMYQLHKPPSDGPPRSNHSAQ

DAVDNLLLLSKAKSVSSEREASPSNSCQDSTDTESNAEEQRSGLIYLTNHINPHARNGLALKEEQRAYEVLRAASENSQDAFRVVSTSGEQLKVYKCEHC

RVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSHITRGEHRYHLS
Transcript ENSMUST00000076700
Sequence
TTGAGGAAGTCATTGTGAAAGAAAGCTGGGAATTGCTCCGCAGCCAACTTAGCAGGGCACTCTAACAAGTGCCTGCGCGGCCGCGCCCGGGCCGGGGACA

GGGGCAGCCCGGCGCAGTACAGCCCATCCCGGGACGCTCGGCCGCGGCTGCCGGAGACCCGGTAGGTCCCGCGGGGTGCAGGAGCCCCCAGATCCCCGGC

TGCTCTTCGCGCCCCAGGATCATTCTTGGCCCCCAAAGCGCGGCGCACAAATCCAC ATAACCTGAAGACAATGGATGTCGATGAGGGTCAAGACATGTC

CCAAGTTTCAG GAAAGGAGAGCCCCCCAGTCAGTGACACTCCAGATGAAGGGGATGAGCCCATGCCTGTCCCTGAGGACCTGTCCACTACCTCTGGAGC

ACAGCAGAACTCCAAGAGTGATCGAGGCATGG CCAGTAATGTTAAAGTAGAGACTCAGAGTGATGAAGAGAATGGGCGTGCCTGTGAAATGAATGGGGA

AGAATGTGCAGAGGATTTACGAATGCTTGATGCCTCGGGAGAGAAAATGAATGGCTCCCACAGGGACCAAGGCAGCTCGGCTTTGTCAGGAGTTGGAGGC

ATTCGACTTCCTAACGGAAAACTAAAGTGTGATATCTGTGGGATCGTTTGCATCGGGCCCAATGTGCTCATGGTTCACAAAAGAAGTCATACTG GTGAA

CGGCCTTTCCAGTGCAACCAGTGTGGGGCCTCCTTTACCCAGAAAGGCAACCTCCTGCGGCACATCAAGCTGCACTCGGGTGAGAAGCCCTTCAAATGCC

ATCTTTGCAACTATGCCTGCCGCCGGAGGGACGCCCTCACCGGCCACCTGAGGACGCACTCCG TTGGTAAGCCTCACAAATGTGGATATTGTGGCCGGA

GCTATAAACAGCGAAGCTCTTTAGAGGAGCATAAAGAGCGATGCCACAACTACTTGGAAAGCATGGGCCTTCCGGGCATGTACCCAG TCATTAAGGAAG

AAACTAACCACAACGAGATGGCAGAAGACCTGTGCAAGATAGGAGCAGAGAGGTCCCTTGTCCTGGACAGGCTGGCAAGCAATGTCGCCAAACGTAAGAG

CTCTATGCCTCAGAAATTTCTTG - UNI30191 - GAGACAAGTGCCTGTCAGACATGCCCTATGACAGTGCCAACTATGAGAAGGAGGATATGATGA

CATCCCACGTGATGGACCAGGCCATCAACAATGCCATCAACTACCTGGGGGCTGAGTCCCTGCGCCCATTGGTGCAGACACCCCCCGGTAGCTCCGAGGT

GGTGCCAGTCATCAGCTCCATGTACCAGCTGCACAAGCCCCCCTCAGATGGCCCCCCACGGTCCAACCATTCAGCACAGGACGCCGTGGATAACTTGCTG

CTGCTGTCCAAGGCCAAGTCTGTGTCATCGGAGCGAGAGGCCTCCCCGAGCAACAGCTGCCAAGACTCCACAGATACAGAGAGCAACGCGGAGGAACAGC

GCAGCGGCCTTATCTACCTAACCAACCACATCAACCCGCATGCACGCAATGGGCTGGCTCTCAAGGAGGAGCAGCGCGCCTACGAGGTGCTGAGGGCGGC

CTCAGAGAACTCGCAGGATGCCTTCCGTGTGGTCAGCACGAGTGGCGAGCAGCTGAAGGTGTACAAGTGCGAACACTGCCGCGTGCTCTTCCTGGATCAC

GTCATGTATACCATTCACATGGGCTGCCATGGCTTTCGGGATCCCTTTGAGTGTAACATGTGTGGTTATCACAGCCAGGACAGGTACGAGTTCTCATCCC

ATATCACGCGGGGGGAGCATCGTTACCACCTGAGCTAAACCCAGCCAGGCCCCACTGAAGCACAAAGATAGCTGGTTATGCCTCCTTCCCGGCAGCTGGA

CCCACAGCGGACAATGTTGGGAGTGGATTTGCAGGCAGCATTTGTTCTTTTATGTTGGTTGTTTGGCGTTTGATTTGCGTTGGAAGATAAGTTTTTAATG

TTAGTGACAGGATTGCATTGCATCAGGAACATTCACAACATCCATCCTTCTAGCCAGTTTTGTTCACTGGTAGCTGAGGTTTCCCGGATATGTGGCTTCC

TAACACTCTCCCCACCCACCCCACCCCCCAAAACAGAGCCTGAATCTTCATGAAGTGAATAAAACAATTATCCAAGAAGGAGTAAGGTGGATCTTGCCCT

AAGCAGAGTTTATGCCACAAAGATTCTCCAAATCCCCCAAGACAGCACAGCCACTGGGGTTGAGCCATCTCAGGGAGCTCTGCAGGTGAGCCAGAGGACC

AGATATAAGGCAGCTGGGGAGGAGCAGGGACATCAGCCTGTGCAGAGACCAAGGCCAAAGGTTGAACTTTGAAAGACTATTAAGTCATATATTGTATGGC

AATATGGTGTCTGGACAAGTTGTGCAATGTGCTGAAGGGAAGGGATTGGAGAGCCTTGAAGACTCTTCTTCATTTGCCTGATCAACCCGACCTCCAGAGG

GTTTGTTGCCCAGTAAGACGAGCTCAGTGCTCTTGTGATCATTTTTCTCTTATCGTTTCCATGCCGTTGATGGCCCTGAAGCTCATCACTGCATTTTAGA

ACCCAATCCTGAAATTGGGACCTTTTTTTTAAACTTCTGATACTGTAAAACTTCTTGGAAGCCAAAGCTTTCTTCCAAGCCCCATCCTCAGTTATCCTGG

TTCCTGTTCTTCCCCGAGCTGATAGTACCAGGACCTGTTATTCCACAAAAGCACAGGCATCCGTCACTTCAATTCAATCCCTGTTCAGATTATAGATATG

GACTTTGCTATCTTGATAAATGTCTTCTCTATGTTATTTTGTCTGAAAAACCTATAAAACCATTATTAAGAATGACCATTTTTAGATGGAAGAAATGAGC

CCAGCATCTCAGTGGCTAAAACACAAAATATCCATGCTTTTAAACAAAATTGTTAAATATTCCGAAGCTCTCTAGTATAAACACCAAGTAGCATGTGTTT

TCACATAAAGAAGACAGGGGCCATGCAACCTTTATCAAGTGGAGGTATTAGAATGTTGTAATGTTTGGAGACACAGTGTGACCAGTACAGGTTCCCAGAG

AGGAATGCCCACCATATCACAGAAAGGTAGAGGTGGGATCTGGTATAGCCAGACCAAGACAGGGATGTCACGCTGAAGCCAAGTCAGTTAGCTGAAGATT

CTCAACAGGAAGGCCTCTCTTAAGAGTCAGTAATAGGGTTGTTACCATCCACCACCTCAACAAAACAAAAAGCTTATAATTGTAAATGTTTACAGCACTG

TCTTCGCAGAAACTTTCTGAGGTGATTCCAAAGAACTAGAGGGGAGATGGTCTATAACAGCTCTTGAAGTAAACGAGGTTCTTAGTCTCAGCTCTCCTGA

CATATAGGGCTTGATCATTACTGGTAGGGATTGTTCTGTGAATTGCTTACTACTACCCCTGGTCTCTCCCCAGTAGATGCCAGGAACATTCTAGCTGATA

CCTAACTGTCTTCCCAGGTGTTCGAGGGAGCAAACCACTGATCTAAACTCTAAACGCTGAAGTACGCAGGTTTTCTAAAAATGACAAGCCCTTGAAACCT

TTCCCAGTAGGCAGCCTCGAGCTGGACTTGTGTCTTTGGAATGCTGATGAATTCTATAGATCAGCATTGCAAATACACTTCAAATACGTCTGAGTTCAAG

TGCAGGGACTGAGTTCACCAAGGTGTGAAATGTGCTCAAAAAGTTCAAAAGTGTGTGTTTCTTTGTTTCTAAAACATTGTGGCATCTTTTTCATTTGTTT

CTAAAACTTTTTTTTTAGAAACAAATGAAGCACTTGGAAAGTGAAAGTAAAATTACAAATATAAGGATTTACACTGAAGAGAGAAAAATTTTAGGAACTA

TAGCTGTGAAAAGATTTTGTTCAAAAGGCAGGCTAGCCTTACCCAAATTCATATATGGCAGGTGTCAACCTCCCAAGCTTACAGTTAGCAGGCAGCTTTT

GCTCACTCATCCTTAGCCATGAGAGCCATTAAGTGTGGTCCAAGAAAGATGGCTCCAAACCCTACCCCCGACCCACCAGTGGTATTCAGAGATTAAAGCA

GAATTGTAAATAGTGGCTTCAGGAGCTCTTTTTTAGAATGCTTTGCCCCTTCCTCTCACTGCCTTTTTTAGCCAATATAAATGTCAATTTGCACACCTTT

TGTTGTGGTTTTATATTGTAACAGCATTTTTTTGAAACTATTGTATTTAAGATAAGGTTTCATATTATGTCCACAAGTAATTAAATTATGTTTGAAGGTG

GCTATATGCTGTATCAGAAGTTGATGATGTTTTTCTTTAGCTGGTAAAGGAGGGTTTTGCATGACCTCACTGTTTGTTCTGTGGTTTGTTCTGTTGTATG

ATGTGTGTCTTGAGTTTTGCTGTGTGATGAAGTGCGCTGAGATTCCAGTGCCCTCAAGTTGTGTTTTAAGTAGCTATCAGAGGCAAGAGGGTTCCTAAGA

GCAGGTTGACCTGTTGGCGACAGATGGCAATCACCATTTCTCATTCCTTCTTCTCCCTGTTACCCCAGCTTCCTGTCCCAGGTCCCTTCTGTGATTCTTA

CCTTAGTGTGCATGTGTGTCTGTCCTGGTGAGAGTCAGGAGCATCGATATGTTATCATTGCATTATCACCAAGGGCACGCACAGCCTAGCACCTGTTGCT

TCAGATACCGTCACACTCTGTTTCCAATTTAGATACAACCACATAATAAAATGTTAGAGTCTTCAATGGGAAGCAGAGGTGCTTGTTATAAAGATGGGGG

CTTATGCTTGTGTCACATTTTGTGTTCTTTTCTTCTTTTGTTTGGTTTTAACTTAATTGTGACCCTTGTAACATCATCTTGCCAAAAAAAAAAAAAAAGT

TGAACTGGATTTATGTAGACATGTCAAGACGTACTATCTATTTCTTTGTCAGTTATAGCAATAAGAGTGGATAAACTCTAAAATCCAGATCTCCCACAAT

GAACATCCGTGTTCTTTCTATGATTTTTCTTTCTTTATGGTGAGCCACAATTAAACTTGAGATGTACAGCCACCCAAACCCAGGAAGCTCATGTGCATCT

GGTGCTATGGCACTCACTGTGAATAAGTGTGACCAGATATTAATATGCAATATTGTTTCCAATCCTTTCTAATACATTTTTTC
Translation
 MDVDEGQDMSQVSG GKESPPVSDTPDEGDEPMPVPEDLSTTSGAQQNSKSDRGMA ASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGS

HRDQGSSALSGVGGIRLPNGKLKCDICGIVCIGPNVLMVHKRSHTG GERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLR

THSV VGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPGMYPV VIKEETNHNEMAEDLCKIGAERSLVLDRLASNVAKRKSSMPQKFLG - UNI

30191 - GDKCLSDMPYDSANYEKEDMMTSHVMDQAINNAINYLGAESLRPLVQTPPGSSEVVPVISSMYQLHKPPSDGPPRSNHSAQDAVDNLLLLSK

AKSVSSEREASPSNSCQDSTDTESNAEEQRSGLIYLTNHINPHARNGLALKEEQRAYEVLRAASENSQDAFRVVSTSGEQLKVYKCEHCRVLFLDHVMYT

IHMGCHGFRDPFECNMCGYHSQDRYEFSSHITRGEHRYHLS
Transcript ENSMUST00000095252
Sequence
GTCAGGGTCCCGAAGCCGCGTGCCGTGCGCGCAGGCCGGGTGGGCTGTGGGACAAGCCGAGCGGGAGGCGAGTCGCAAGCGCCAACCCAAAGTTTGCACG

GTGCGGGGCGAGGGGCGCGCGCTCCGGGCTGCCGCAGGTGGCGGCGCGGTGAGCCCGGGCCAGGTGCCCCGGCAGCGGGGCGGCGCTGTCGTGCGGGACA

GCCGGGCTGCCAGGGGCTCGGAGCCGGGTCGGAGCCCGCGGGGGGCGGGGAGTGTGGCGAGAAATGGGGAACAATGCGAGTGAGCAACTTGAGGAAGTCA

TTGTGAAAGAAAGCTGGGAATTGCTCCGCAGCCAACTTAGCAGGGCACTCTAACAAGTGCCTGCGCGGCCGCGCCCGGGCCGGGGACAGGGGCAGCCCGG

CGCAGTACAGCCCATCCCGGGACGCTCGGCCGCGGCTGCCGGAGACCCGGTAGGTCCCGCGGGGTGCAGGAGCCCCCAGATCCCCGGCTGCTCTTCGCGC

CCCAGGATCATTCTTGGCCCCCAAAGCGCGGCGCACAAATCCAC ATAACCTGAAGACAATGGATGTCGATGAGGGTCAAGACATGTCCCAAGTTTCAG 

GAAAGGAGAGCCCCCCAGTCAGTGACACTCCAGATGAAGGGGATGAGCCCATGCCTGTCCCTGAGGACCTGTCCACTACCTCTGGAGCACAGCAGAACTC

CAAGAGTGATCGAGGCATGG CATATGGGGCTGATGGCTTTAGGGATTTTCATGCAATAATTCCCAAATCTTTCTCTC CCAGTAATGTTAAAGTAGAGA

CTCAGAGTGATGAAGAGAATGGGCGTGCCTGTGAAATGAATGGGGAAGAATGTGCAGAGGATTTACGAATGCTTGATGCCTCGGGAGAGAAAATGAATGG

CTCCCACAGGGACCAAGGCAGCTCGGCTTTGTCAGGAGTTGGAGGCATTCGACTTCCTAACGGAAAACTAAAGTGTGATATCTGTGGGATCGTTTGCATC

GGGCCCAATGTGCTCATGGTTCACAAAAGAAGTCATACTG - UNI30191 - ACAAGTGCCTGTCAGACATGCCCTATGACAGTGCCAACTATGAGAA

GGAGGATATGATGACATCCCACGTGATGGACCAGGCCATCAACAATGCCATCAACTACCTGGGGGCTGAGTCCCTGCGCCCATTGGTGCAGACACCCCCC

GGTAGCTCCGAGGTGGTGCCAGTCATCAGCTCCATGTACCAGCTGCACAAGCCCCCCTCAGATGGCCCCCCACGGTCCAACCATTCAGCACAGGACGCCG

TGGATAACTTGCTGCTGCTGTCCAAGGCCAAGTCTGTGTCATCGGAGCGAGAGGCCTCCCCGAGCAACAGCTGCCAAGACTCCACAGATACAGAGAGCAA

CGCGGAGGAACAGCGCAGCGGCCTTATCTACCTAACCAACCACATCAACCCGCATGCACGCAATGGGCTGGCTCTCAAGGAGGAGCAGCGCGCCTACGAG

GTGCTGAGGGCGGCCTCAGAGAACTCGCAGGATGCCTTCCGTGTGGTCAGCACGAGTGGCGAGCAGCTGAAGGTGTACAAGTGCGAACACTGCCGCGTGC

TCTTCCTGGATCACGTCATGTATACCATTCACATGGGCTGCCATGGCTTTCGGGATCCCTTTGAGTGTAACATGTGTGGTTATCACAGCCAGGACAGGTA

CGAGTTCTCATCCCATATCACGCGGGGGGAGCATCGTTACCACCTGAGCTAA
Translation
 MDVDEGQDMSQVSG GKESPPVSDTPDEGDEPMPVPEDLSTTSGAQQNSKSDRGMA AYGADGFRDFHAIIPKSFSP PSNVKVETQSDEENGRACEMN

GEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIVCIGPNVLMVHKRSHTD - UNI30191 - DKCLSDMPYDSANYEKEDM

MTSHVMDQAINNAINYLGAESLRPLVQTPPGSSEVVPVISSMYQLHKPPSDGPPRSNHSAQDAVDNLLLLSKAKSVSSEREASPSNSCQDSTDTESNAEE

QRSGLIYLTNHINPHARNGLALKEEQRAYEVLRAASENSQDAFRVVSTSGEQLKVYKCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFS

SHITRGEHRYHLS
Transcript ENSMUST00000109673
Sequence
GTCAGGGTCCCGAAGCCGCGTGCCGTGCGCGCAGGCCGGGTGGGCTGTGGGACAAGCCGAGCGGGAGGCGAGTCGCAAGCGCCAACCCAAAGTTTGCACG

GTGCGGGGCGAGGGGCGCGCGCTCCGGGCTGCCGCAGGTGGCGGCGCGGTGAGCCCGGGCCAGGTGCCCCGGCAGCGGGGCGGCGCTGTCGTGCGGGACA

GCCGGGCTGCCAGGGGCTCGGAGCCGGGTCGGAGCCCGCGGGGGGCGGGGAGTGTGGCGAGAAATGGGGAACAATGCGAGTGAGCAACTTGAGGAAGTCA

TTGTGAAAGAAAGCTGGGAATTGCTCCGCAGCCAACTTAGCAGGGCACTCTAACAAGTGCCTGCGCGGCCGCGCCCGGGCCGGGGACAGGGGCAGCCCGG

CGCAGTACAGCCCATCCCGGGACGCTCGGCCGCGGCTGCCGGAGACCCGGTAGGTCCCGCGGGGTGCAGGAGCCCCCAGATCCCCGGCTGCTCTTCGCGC

CCCAGGATCATTCTTGGCCCCCAAAGCGCGGCGCACAAATCCAC ATAACCTGAAGACAATGGATGTCGATGAGGGTCAAGACATGTCCCAAGTTTCAG 

GAAAGGAGAGCCCCCCAGTCAGTGACACTCCAGATGAAGGGGATGAGCCCATGCCTGTCCCTGAGGACCTGTCCACTACCTCTGGAGCACAGCAGAACTC

CAAGAGTGATCGAGGCATGG TTGCATATGGGGCTGATGGCTTTAGGGATTTTCATGCAATAATTCC TGACAGAA - UNI30191 - TAATGG GAG

ACAAGTGCCTGTCAGACATGCCCTATGACAGTGCCAACTATGAGAAGGAGGATATGATGACATCCCACGTGATGGACCAGGCCATCAACAATGCCATCAA

CTACCTGGGGGCTGAGTCCCTGCGCCCATTGGTGCAGACACCCCCCGGTAGCTCCGAGGTGGTGCCAGTCATCAGCTCCATGTACCAGCTGCACAAGCCC

CCCTCAGATGGCCCCCCACGGTCCAACCATTCAGCACAGGACGCCGTGGATAACTTGCTGCTGCTGTCCAAGGCCAAGTCTGTGTCATCGGAGCGAGAGG

CCTCCCCGAGCAACAGCTGCCAAGACTCCACAGATACAGAGAGCAACGCGGAGGAACAGCGCAGCGGCCTTATCTACCTAACCAACCACATCAACCCGCA

TGCACGCAATGGGCTGGCTCTCAAGGAGGAGCAGCGCGCCTACGAGGTGCTGAGGGCGGCCTCAGAGAACTCGCAGGATGCCTTCCGTGTGGTCAGCACG

AGTGGCGAGCAGCTGAAGGTGTACAAGTGCGAACACTGCCGCGTGCTCTTCCTGGATCACGTCATGTATACCATTCACATGGGCTGCCATGGCTTTCGGG

ATCCCTTTGAGTGTAACATGTGTGGTTATCACAGCCAGGACAGGTACGAGTTCTCATCCCATATCACGCGGGGGGAGCATCGTTACCACCTGAGCTAAAC

CCAGCCAGGCCCCACTGAAGCACAAAGATAGCTGGTTATGCCTCCTTCCCGGCAGCTGGACCCACAGCGGACAATGTTGGGAGTGGATTTGCAGGCAGCA

TTTGTTCTTTTATGTTGGTTGTTTGGCGTTTGATTTGCGTTGGAAGATAAGTTTTTAATGTTAGTGACAGGATTGCATTGCATCAGGAACATTCACAACA

TCCATCCTTCTAGCCAGTTTTGTTCACTGGTAGCTGAGGTTTCCCGGATATGTGGCTTCCTAACACTCTCCCCACCCACCCCACCCCCCAAAACAGAGCC

TGAATCTTCATGAAGTGAATAAAACAATTATCCAAGAAGGAGTAAGGTGGATCTTGCCCTAAGCAGAGTTTATGCCACAAAGATTCTCCAAATCCCCCAA

GACAGCACAGCCACTGGGGTTGAGCCATCTCAGGGAGCTCTGCAGGTGAGCCAGAGGACCAGATATAAGGCAGCTGGGGAGGAGCAGGGACATCAGCCTG

TGCAGAGACCAAGGCCAAAGGTTGAACTTTGAAAGACTATTAAGTCATATATTGTATGGCAATATGGTGTCTGGACAAGTTGTGCAATGTGCTGAAGGGA

AGGGATTGGAGAGCCTTGAAGACTCTTCTTCATTTGCCTGATCAACCCGACCTCCAGAGGGTTTGTTGCCCAGTAAGACGAGCTCAGTGCTCTTGTGATC

ATTTTTCTCTTATCGTTTCCATGCCGTTGATGGCCCTGAAGCTCATCACTGCATTTTAGAACCCAATCCTGAAATTGGGACCTTTTTTTTAAACTTCTGA

TACTGTAAAACTTCTTGGAAGCCAAAGCTTTCTTCCAAGCCCCATCCTCAGTTATCCTGGTTCCTGTTCTTCCCCGAGCTGATAGTACCAGGACCTGTTA

TTCCACAAAAGCACAGGCATCCGTCACTTCAATTCAATCCCTGTTCAGATTATAGATATGGACTTTGCTATCTTGATAAATGTCTTCTCTATGTTATTTT

GTCTGAAAAACCTATAAAACCATTATTAAGAATGACCATTTTTAGATGGAAGAAATGAGCCCAGCATCTCAGTGGCTAAAACACAAAATATCCATGCTTT

TAAACAAAATTGTTAAATATTCCGAAGCTCTCTAGTATAAACACCAAGTAGCATGTGTTTTCACATAAAGAAGACAGGGGCCATGCAACCTTTATCAAGT

GGAGGTATTAGAATGTTGTAATGTTTGGAGACACAGTGTGACCAGTACAGGTTCCCAGAGAGGAATGCCCACCATATCACAGAAAGGTAGAGGTGGGATC

TGGTATAGCCAGACCAAGACAGGGATGTCACGCTGAAGCCAAGTCAGTTAGCTGAAGATTCTCAACAGGAAGGCCTCTCTTAAGAGTCAGTAATAGGGTT

GTTACCATCCACCACCTCAACAAAACAAAAAGCTTATAATTGTAAATGTTTACAGCACTGTCTTCGCAGAAACTTTCTGAGGTGATTCCAAAGAACTAGA

GGGGAGATGGTCTATAACAGCTCTTGAAGTAAACGAGGTTCTTAGTCTCAGCTCTCCTGACATATAGGGCTTGATCATTACTGGTAGGGATTGTTCTGTG

AATTGCTTACTACTACCCCTGGTCTCTCCCCAGTAGATGCCAGGAACATTCTAGCTGATACCTAACTGTCTTCCCAGGTGTTCGAGGGAGCAAACCACTG

ATCTAAACTCTAAACGCTGAAGTACGCAGGTTTTCTAAAAATGACAAGCCCTTGAAACCTTTCCCAGTAGGCAGCCTCGAGCTGGACTTGTGTCTTTGGA

ATGCTGATGAATTCTATAGATCAGCATTGCAAATACACTTCAAATACGTCTGAGTTCAAGTGCAGGGACTGAGTTCACCAAGGTGTGAAATGTGCTCAAA

AAGTTCAAAAGTGTGTGTTTCTTTGTTTCTAAAACATTGTGGCATCTTTTTCATTTGTTTCTAAAACTTTTTTTTTAGAAACAAATGAAGCACTTGGAAA

GTGAAAGTAAAATTACAAATATAAGGATTTACACTGAAGAGAGAAAAATTTTAGGAACTATAGCTGTGAAAAGATTTTGTTCAAAAGGCAGGCTAGCCTT

ACCCAAATTCATATATGGCAGGTGTCAACCTCCCAAGCTTACAGTTAGCAGGCAGCTTTTGCTCACTCATCCTTAGCCATGAGAGCCATTAAGTGTGGTC

CAAGAAAGATGGCTCCAAACCCTACCCCCGACCCACCAGTGGTATTCAGAGATTAAAGCAGAATTGTAAATAGTGGCTTCAGGAGCTCTTTTTTAGAATG

CTTTGCCCCTTCCTCTCACTGCCTTTTTTAGCCAATATAAATGTCAATTTGCACACCTTTTGTTGTGGTTTTATATTGTAACAGCATTTTTTTGAAACTA

TTGTATTTAAGATAAGGTTTCATATTATGTCCACAAGTAATTAAATTATGTTTGAAGGTGGCTATATGCT
Translation
 MDVDEGQDMSQVSG GKESPPVSDTPDEGDEPMPVPEDLSTTSGAQQNSKSDRGMV VAYGADGFRDFHAIIP PDRI - UNI30191 - IMG GDK

CLSDMPYDSANYEKEDMMTSHVMDQAINNAINYLGAESLRPLVQTPPGSSEVVPVISSMYQLHKPPSDGPPRSNHSAQDAVDNLLLLSKAKSVSSEREAS

PSNSCQDSTDTESNAEEQRSGLIYLTNHINPHARNGLALKEEQRAYEVLRAASENSQDAFRVVSTSGEQLKVYKCEHCRVLFLDHVMYTIHMGCHGFRDP

FECNMCGYHSQDRYEFSSHITRGEHRYHLS
Transcript ENSMUST00000081221
Sequence
GTCAGGGTCCCGAAGCCGCGTGCCGTGCGCGCAGGCCGGGTGGGCTGTGGGACAAGCCGAGCGGGAGGCGAGTCGCAAGCGCCAACCCAAAGTTTGCACG

GTGCGGGGCGAGGGGCGCGCGCTCCGGGCTGCCGCAGGTGGCGGCGCGGTGAGCCCGGGCCAGGTGCCCCGGCAGCGGGGCGGCGCTGTCGTGCGGGACA

GCCGGGCTGCCAGGGGCTCGGAGCCGGGTCGGAGCCCGCGGGGGGCGGGGAGTGTGGCGAGAAATGGGGAACAATGCGAGTGAGCAACTTGAGGAAGTCA

TTGTGAAAGAAAGCTGGGAATTGCTCCGCAGCCAACTTAGCAGGGCACTCTAACAAGTGCCTGCGCGGCCGCGCCCGGGCCGGGGACAGGGGCAGCCCGG

CGCAGTACAGCCCATCCCGGGACGCTCGGCCGCGGCTGCCGGAGACCCGGTAGGTCCCGCGGGGTGCAGGAGCCCCCAGATCCCCGGCTGCTCTTCGCGC

CCCAGGATCATTCTTGGCCCCCAAAGCGCGGCGCACAAATCCAC ATAACCTGAAGACAATGGATGTCGATGAGGGTCAAGACATGTCCCAAGTTTCAG 

GAAAGGAGAGCCCCCCAGTCAGTGACACTCCAGATGAAGGGGATGAGCCCATGCCTGTCCCTGAGGACCTGTCCACTACCTCTGGAGCACAGCAGAACTC

CAAGAGTGATCGAGGCATGG TTGGTAAGCCTCACAAATGTGGATATTGTGGCCGGAGCTATAAACAGCGAAGCTCTTTAGAGGAGCATAAAGAGCGATG

CCACAACTACTTGGAAAGCATGGGCCTTCCGGGCATGTACCCAG - UNI30191 - GAGACAAGTGCCTGTCAGACATGCCCTATGACAGTGCCAACT

ATGAGAAGGAGGATATGATGACATCCCACGTGATGGACCAGGCCATCAACAATGCCATCAACTACCTGGGGGCTGAGTCCCTGCGCCCATTGGTGCAGAC

ACCCCCCGGTAGCTCCGAGGTGGTGCCAGTCATCAGCTCCATGTACCAGCTGCACAAGCCCCCCTCAGATGGCCCCCCACGGTCCAACCATTCAGCACAG

GACGCCGTGGATAACTTGCTGCTGCTGTCCAAGGCCAAGTCTGTGTCATCGGAGCGAGAGGCCTCCCCGAGCAACAGCTGCCAAGACTCCACAGATACAG

AGAGCAACGCGGAGGAACAGCGCAGCGGCCTTATCTACCTAACCAACCACATCAACCCGCATGCACGCAATGGGCTGGCTCTCAAGGAGGAGCAGCGCGC

CTACGAGGTGCTGAGGGCGGCCTCAGAGAACTCGCAGGATGCCTTCCGTGTGGTCAGCACGAGTGGCGAGCAGCTGAAGGTGTACAAGTGCGAACACTGC

CGCGTGCTCTTCCTGGATCACGTCATGTATACCATTCACATGGGCTGCCATGGCTTTCGGGATCCCTTTGAGTGTAACATGTGTGGTTATCACAGCCAGG

ACAGGTACGAGTTCTCATCCCATATCACGCGGGGGGAGCATCGTTACCACCTGAGCTAAACCCAGCCAGGCCCCACTGAAGCACAAAGATAGCTGGTTAT

GCCTCCTTCCCGGCAGCTGGACCCACAGCGGACAATGTTGGGAGTGGATTTGCAGGCAGCATTTGTTCTTTTATGTTGGTTGTTTGGCGTTTGATTTGCG

TTGGAAGATAAGTTTTTAATGTTAGTGACAGGATTGCATTGCATCAGGAACATTCACAACATCCATCCTTCTAGCCAGTTTTGTTCACTGGTAGCTGAGG

TTTCCCGGATATGTGGCTTCCTAACACTCTCCCCACCCACCCCACCCCCCAAAACAGAGCCTGAATCTTCATGAAGTGAATAAAACAATTATCCAAGAAG

GAGTAAGGTGGATCTTGCCCTAAGCAGAGTTTATGCCACAAAGATTCTCCAAATCCCCCAAGACAGCACAGCCACTGGGGTTGAGCCATCTCAGGGAGCT

CTGCAGGTGAGCCAGAGGACCAGATATAAGGCAGCTGGGGAGGAGCAGGGACATCAGCCTGTGCAGAGACCAAGGCCAAAGGTTGAACTTTGAAAGACTA

TTAAGTCATATATTGTATGGCAATATGGTGTCTGGACAAGTTGTGCAATGTGCTGAAGGGAAGGGATTGGAGAGCCTTGAAGACTCTTCTTCATTTGCCT

GATCAACCCGACCTCCAGAGGGTTTGTTGCCCAGTAAGACGAGCTCAGTGCTCTTGTGATCATTTTTCTCTTATCGTTTCCATGCCGTTGATGGCCCTGA

AGCTCATCACTGCATTTTAGAACCCAATCCTGAAATTGGGACCTTTTTTTTAAACTTCTGATACTGTAAAACTTCTTGGAAGCCAAAGCTTTCTTCCAAG

CCCCATCCTCAGTTATCCTGGTTCCTGTTCTTCCCCGAGCTGATAGTACCAGGACCTGTTATTCCACAAAAGCACAGGCATCCGTCACTTCAATTCAATC

CCTGTTCAGATTATAGATATGGACTTTGCTATCTTGATAAATGTCTTCTCTATGTTATTTTGTCTGAAAAACCTATAAAACCATTATTAAGAATGACCAT

TTTTAGATGGAAGAAATGAGCCCAGCATCTCAGTGGCTAAAACACAAAATATCCATGCTTTTAAACAAAATTGTTAAATATTCCGAAGCTCTCTAGTATA

AACACCAAGTAGCATGTGTTTTCACATAAAGAAGACAGGGGCCATGCAACCTTTATCAAGTGGAGGTATTAGAATGTTGTAATGTTTGGAGACACAGTGT

GACCAGTACAGGTTCCCAGAGAGGAATGCCCACCATATCACAGAAAGGTAGAGGTGGGATCTGGTATAGCCAGACCAAGACAGGGATGTCACGCTGAAGC

CAAGTCAGTTAGCTGAAGATTCTCAACAGGAAGGCCTCTCTTAAGAGTCAGTAATAGGGTTGTTACCATCCACCACCTCAACAAAACAAAAAGCTTATAA

TTGTAAATGTTTACAGCACTGTCTTCGCAGAAACTTTCTGAGGTGATTCCAAAGAACTAGAGGGGAGATGGTCTATAACAGCTCTTGAAGTAAACGAGGT

TCTTAGTCTCAGCTCTCCTGACATATAGGGCTTGATCATTACTGGTAGGGATTGTTCTGTGAATTGCTTACTACTACCCCTGGTCTCTCCCCAGTAGATG

CCAGGAACATTCTAGCTGATACCTAACTGTCTTCCCAGGTGTTCGAGGGAGCAAACCACTGATCTAAACTCTAAACGCTGAAGTACGCAGGTTTTCTAAA

AATGACAAGCCCTTGAAACCTTTCCCAGTAGGCAGCCTCGAGCTGGACTTGTGTCTTTGGAATGCTGATGAATTCTATAGATCAGCATTGCAAATACACT

TCAAATACGTCTGAGTTCAAGTGCAGGGACTGAGTTCACCAAGGTGTGAAATGTGCTCAAAAAGTTCAAAAGTGTGTGTTTCTTTGTTTCTAAAACATTG

TGGCATCTTTTTCATTTGTTTCTAAAACTTTTTTTTTAGAAACAAATGAAGCACTTGGAAAGTGAAAGTAAAATTACAAATATAAGGATTTACACTGAAG

AGAGAAAAATTTTAGGAACTATAGCTGTGAAAAGATTTTGTTCAAAAGGCAGGCTAGCCTTACCCAAATTCATATATGGCAGGTGTCAACCTCCCAAGCT

TACAGTTAGCAGGCAGCTTTTGCTCACTCATCCTTAGCCATGAGAGCCATTAAGTGTGGTCCAAGAAAGATGGCTCCAAACCCTACCCCCGACCCACCAG

TGGTATTCAGAGATTAAAGCAGAATTGTAAATAGTGGCTTCAGGAGCTCTTTTTTAGAATGCTTTGCCCCTTCCTCTCACTGCCTTTTTTAGCCAATATA

AATGTCAATTTGCACACCTTTTGTTGTGGTTTTATATTGTAACAGCATTTTTTTGAAACTATTGTATTTAAGATAAGGTTTCATATTATGTCCACAAGTA

ATTAAATTATGTTTGAAGGTGGCTATATGCT
Translation
 MDVDEGQDMSQVSG GKESPPVSDTPDEGDEPMPVPEDLSTTSGAQQNSKSDRGMV VGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPGMYPG

 - UNI30191 - GDKCLSDMPYDSANYEKEDMMTSHVMDQAINNAINYLGAESLRPLVQTPPGSSEVVPVISSMYQLHKPPSDGPPRSNHSAQDAVDN

LLLLSKAKSVSSEREASPSNSCQDSTDTESNAEEQRSGLIYLTNHINPHARNGLALKEEQRAYEVLRAASENSQDAFRVVSTSGEQLKVYKCEHCRVLFL

DHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSHITRGEHRYHLS
Transcript ENSMUST00000109674
Sequence
GTCAGGGTCCCGAAGCCGCGTGCCGTGCGCGCAGGCCGGGTGGGCTGTGGGACAAGCCGAGCGGGAGGCGAGTCGCAAGCGCCAACCCAAAGTTTGCACG

GTGCGGGGCGAGGGGCGCGCGCTCCGGGCTGCCGCAGGTGGCGGCGCGGTGAGCCCGGGCCAGGTGCCCCGGCAGCGGGGCGGCGCTGTCGTGCGGGACA

GCCGGGCTGCCAGGGGCTCGGAGCCGGGTCGGAGCCCGCGGGGGGCGGGGAGTGTGGCGAGAAATGGGGAACAATGCGAGTGAGCAACTTGAGGAAGTCA

TTGTGAAAGAAAGCTGGGAATTGCTCCGCAGCCAACTTAGCAGGGCACTCTAACAAGTGCCTGCGCGGCCGCGCCCGGGCCGGGGACAGGGGCAGCCCGG

CGCAGTACAGCCCATCCCGGGACGCTCGGCCGCGGCTGCCGGAGACCCGGTAGGTCCCGCGGGGTGCAGGAGCCCCCAGATCCCCGGCTGCTCTTCGCGC

CCCAGGATCATTCTTGGCCCCCAAAGCGCGGCGCACAAATCCAC ATAACCTGAAGACAATGGATGTCGATGAGGGTCAAGACATGTCCCAAGTTTCAG 

GAAAGGAGAGCCCCCCAGTCAGTGACACTCCAGATGAAGGGGATGAGCCCATGCCTGTCCCTGAGGACCTGTCCACTACCTCTGGAGCACAGCAGAACTC

CAAGAGTGATCGAGGCATGG GTGAACGGCCTTTCCAGTGCAACCAGTGTGGGGCCTCCTTTACCCAGAAAGGCAACCTCCTGCGGCACATCAAGCTGCA

CTCGGGTGAGAAGCCCTTCAAATGCCATCTTTGCAACTATGCCTGCCGCCGGAGGGACGCCCTCACCGGCCACCTGAGGACGCACTCCG TCATTAAGGA

AGAAACTAACCACAACGAGATGGCAGAAGACCTGTGCAAGATAGGAGCAGAGAGGTCCCTTGTCCTGGACAGGCTGGCAAGCAATGTCGCCAAACGTAAG

AGCTCTATGCCTCAGAAATTTCTTG - UNI30191 - GAGACAAGTGCCTGTCAGACATGCCCTATGACAGTGCCAACTATGAGAAGGAGGATATGAT

GACATCCCACGTGATGGACCAGGCCATCAACAATGCCATCAACTACCTGGGGGCTGAGTCCCTGCGCCCATTGGTGCAGACACCCCCCGGTAGCTCCGAG

GTGGTGCCAGTCATCAGCTCCATGTACCAGCTGCACAAGCCCCCCTCAGATGGCCCCCCACGGTCCAACCATTCAGCACAGGACGCCGTGGATAACTTGC

TGCTGCTGTCCAAGGCCAAGTCTGTGTCATCGGAGCGAGAGGCCTCCCCGAGCAACAGCTGCCAAGACTCCACAGATACAGAGAGCAACGCGGAGGAACA

GCGCAGCGGCCTTATCTACCTAACCAACCACATCAACCCGCATGCACGCAATGGGCTGGCTCTCAAGGAGGAGCAGCGCGCCTACGAGGTGCTGAGGGCG

GCCTCAGAGAACTCGCAGGATGCCTTCCGTGTGGTCAGCACGAGTGGCGAGCAGCTGAAGGTGTACAAGTGCGAACACTGCCGCGTGCTCTTCCTGGATC

ACGTCATGTATACCATTCACATGGGCTGCCATGGCTTTCGGGATCCCTTTGAGTGTAACATGTGTGGTTATCACAGCCAGGACAGGTACGAGTTCTCATC

CCATATCACGCGGGGGGAGCATCGTTACCACCTGAGCTAAACCCAGCCAGGCCCCACTGAAGCACAAAGATAGCTGGTTATGCCTCCTTCCCGGCAGCTG

GACCCACAGCGGACAATGTTGGGAGTGGATTTGCAGGCAGCATTTGTTCTTTTATGTTGGTTGTTTGGCGTTTGATTTGCGTTGGAAGATAAGTTTTTAA

TGTTAGTGACAGGATTGCATTGCATCAGGAACATTCACAACATCCATCCTTCTAGCCAGTTTTGTTCACTGGTAGCTGAGGTTTCCCGGATATGTGGCTT

CCTAACACTCTCCCCACCCACCCCACCCCCCAAAACAGAGCCTGAATCTTCATGAAGTGAATAAAACAATTATCCAAGAAGGAGTAAGGTGGATCTTGCC

CTAAGCAGAGTTTATGCCACAAAGATTCTCCAAATCCCCCAAGACAGCACAGCCACTGGGGTTGAGCCATCTCAGGGAGCTCTGCAGGTGAGCCAGAGGA

CCAGATATAAGGCAGCTGGGGAGGAGCAGGGACATCAGCCTGTGCAGAGACCAAGGCCAAAGGTTGAACTTTGAAAGACTATTAAGTCATATATTGTATG

GCAATATGGTGTCTGGACAAGTTGTGCAATGTGCTGAAGGGAAGGGATTGGAGAGCCTTGAAGACTCTTCTTCATTTGCCTGATCAACCCGACCTCCAGA

GGGTTTGTTGCCCAGTAAGACGAGCTCAGTGCTCTTGTGATCATTTTTCTCTTATCGTTTCCATGCCGTTGATGGCCCTGAAGCTCATCACTGCATTTTA

GAACCCAATCCTGAAATTGGGACCTTTTTTTTAAACTTCTGATACTGTAAAACTTCTTGGAAGCCAAAGCTTTCTTCCAAGCCCCATCCTCAGTTATCCT

GGTTCCTGTTCTTCCCCGAGCTGATAGTACCAGGACCTGTTATTCCACAAAAGCACAGGCATCCGTCACTTCAATTCAATCCCTGTTCAGATTATAGATA

TGGACTTTGCTATCTTGATAAATGTCTTCTCTATGTTATTTTGTCTGAAAAACCTATAAAACCATTATTAAGAATGACCATTTTTAGATGGAAGAAATGA

GCCCAGCATCTCAGTGGCTAAAACACAAAATATCCATGCTTTTAAACAAAATTGTTAAATATTCCGAAGCTCTCTAGTATAAACACCAAGTAGCATGTGT

TTTCACATAAAGAAGACAGGGGCCATGCAACCTTTATCAAGTGGAGGTATTAGAATGTTGTAATGTTTGGAGACACAGTGTGACCAGTACAGGTTCCCAG

AGAGGAATGCCCACCATATCACAGAAAGGTAGAGGTGGGATCTGGTATAGCCAGACCAAGACAGGGATGTCACGCTGAAGCCAAGTCAGTTAGCTGAAGA

TTCTCAACAGGAAGGCCTCTCTTAAGAGTCAGTAATAGGGTTGTTACCATCCACCACCTCAACAAAACAAAAAGCTTATAATTGTAAATGTTTACAGCAC

TGTCTTCGCAGAAACTTTCTGAGGTGATTCCAAAGAACTAGAGGGGAGATGGTCTATAACAGCTCTTGAAGTAAACGAGGTTCTTAGTCTCAGCTCTCCT

GACATATAGGGCTTGATCATTACTGGTAGGGATTGTTCTGTGAATTGCTTACTACTACCCCTGGTCTCTCCCCAGTAGATGCCAGGAACATTCTAGCTGA

TACCTAACTGTCTTCCCAGGTGTTCGAGGGAGCAAACCACTGATCTAAACTCTAAACGCTGAAGTACGCAGGTTTTCTAAAAATGACAAGCCCTTGAAAC

CTTTCCCAGTAGGCAGCCTCGAGCTGGACTTGTGTCTTTGGAATGCTGATGAATTCTATAGATCAGCATTGCAAATACACTTCAAATACGTCTGAGTTCA

AGTGCAGGGACTGAGTTCACCAAGGTGTGAAATGTGCTCAAAAAGTTCAAAAGTGTGTGTTTCTTTGTTTCTAAAACATTGTGGCATCTTTTTCATTTGT

TTCTAAAACTTTTTTTTTAGAAACAAATGAAGCACTTGGAAAGTGAAAGTAAAATTACAAATATAAGGATTTACACTGAAGAGAGAAAAATTTTAGGAAC

TATAGCTGTGAAAAGATTTTGTTCAAAAGGCAGGCTAGCCTTACCCAAATTCATATATGGCAGGTGTCAACCTCCCAAGCTTACAGTTAGCAGGCAGCTT

TTGCTCACTCATCCTTAGCCATGAGAGCCATTAAGTGTGGTCCAAGAAAGATGGCTCCAAACCCTACCCCCGACCCACCAGTGGTATTCAGAGATTAAAG

CAGAATTGTAAATAGTGGCTTCAGGAGCTCTTTTTTAGAATGCTTTGCCCCTTCCTCTCACTGCCTTTTTTAGCCAATATAAATGTCAATTTGCACACCT

TTTGTTGTGGTTTTATATTGTAACAGCATTTTTTTGAAACTATTGTATTTAAGATAAGGTTTCATATTATGTCCACAAGTAATTAAATTATGTTTGAAGG

TGGCTATATGCT
Translation
 MDVDEGQDMSQVSG GKESPPVSDTPDEGDEPMPVPEDLSTTSGAQQNSKSDRGMG GERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYAC

RRRDALTGHLRTHSV VIKEETNHNEMAEDLCKIGAERSLVLDRLASNVAKRKSSMPQKFLG - UNI30191 - GDKCLSDMPYDSANYEKEDMMTSH

VMDQAINNAINYLGAESLRPLVQTPPGSSEVVPVISSMYQLHKPPSDGPPRSNHSAQDAVDNLLLLSKAKSVSSEREASPSNSCQDSTDTESNAEEQRSG

LIYLTNHINPHARNGLALKEEQRAYEVLRAASENSQDAFRVVSTSGEQLKVYKCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSHIT

RGEHRYHLS
Transcript ENSMUST00000065433
Sequence
GTCAGGGTCCCGAAGCCGCGTGCCGTGCGCGCAGGCCGGGTGGGCTGTGGGACAAGCCGAGCGGGAGGCGAGTCGCAAGCGCCAACCCAAAGTTTGCACG

GTGCGGGGCGAGGGGCGCGCGCTCCGGGCTGCCGCAGGTGGCGGCGCGGTGAGCCCGGGCCAGGTGCCCCGGCAGCGGGGCGGCGCTGTCGTGCGGGACA

GCCGGGCTGCCAGGGGCTCGGAGCCGGGTCGGAGCCCGCGGGGGGCGGGGAGTGTGGCGAGAAATGGGGAACAATGCGAGTGAGCAACTTGAGGAAGTCA

TTGTGAAAGAAAGCTGGGAATTGCTCCGCAGCCAACTTAGCAGGGCACTCTAACAAGTGCCTGCGCGGCCGCGCCCGGGCCGGGGACAGGGGCAGCCCGG

CGCAGTACAGCCCATCCCGGGACGCTCGGCCGCGGCTGCCGGAGACCCGGTAGGTCCCGCGGGGTGCAGGAGCCCCCAGATCCCCGGCTGCTCTTCGCGC

CCCAGGATCATTCTTGGCCCCCAAAGCGCGGCGCACAAATCCAC ATAACCTGAAGACAATGGATGTCGATGAGGGTCAAGACATGTCCCAAGTTTCAG 

GAAAGGAGAGCCCCCCAGTCAGTGACACTCCAGATGAAGGGGATGAGCCCATGCCTGTCCCTGAGGACCTGTCCACTACCTCTGGAGCACAGCAGAACTC

CAAGAGTGATCGAGGCATGG TTGCATATGGGGCTGATGGCTTTAGGGATTTTCATGCAATAATTCCCAAATCTTTCTCTC CCAGTAATGTTAAAGTAG

AGACTCAGAGTGATGAAGAGAATGGGCGTGCCTGTGAAATGAATGGGGAAGAATGTGCAGAGGATTTACGAATGCTTGATGCCTCGGGAGAGAAAATGAA

TGGCTCCCACAGGGACCAAGGCAGCTCGGCTTTGTCAGGAGTTGGAGGCATTCGACTTCCTAACGGAAAACTAAAGTGTGATATCTGTGGGATCGTTTGC

ATCGGGCCCAATGTGCTCATGGTTCACAAAAGAAGTCATACTG GTGAACGGCCTTTCCAGTGCAACCAGTGTGGGGCCTCCTTTACCCAGAAAGGCAAC

CTCCTGCGGCACATCAAGCTGCACTCGGGTGAGAAGCCCTTCAAATGCCATCTTTGCAACTATGCCTGCCGCCGGAGGGACGCCCTCACCGGCCACCTGA

GGACGCACTCCG TTGGTAAGCCTCACAAATGTGGATATTGTGGCCGGAGCTATAAACAGCGAAGCTCTTTAGAGGAGCATAAAGAGCGATGCCACAACT

ACTTGGAAAGCATGGGCCTTCCGGGCATGTACCCAG TCATTAAGGAAGAAACTAACCACAACGAGATGGCAGAAGACCTGTGCAAGATAGGAGCAGAGA

GGTCCCTTGTCCTGGACAGGCTGGCAAGCAATGTCGCCAAACGTAAGAGCTCTATGCCTCAGAAATTTCTTG - UNI30191 - GAGACAAGTGCCTG

TCAGACATGCCCTATGACAGTGCCAACTATGAGAAGGAGGATATGATGACATCCCACGTGATGGACCAGGCCATCAACAATGCCATCAACTACCTGGGGG

CTGAGTCCCTGCGCCCATTGGTGCAGACACCCCCCGGTAGCTCCGAGGTGGTGCCAGTCATCAGCTCCATGTACCAGCTGCACAAGCCCCCCTCAGATGG

CCCCCCACGGTCCAACCATTCAGCACAGGACGCCGTGGATAACTTGCTGCTGCTGTCCAAGGCCAAGTCTGTGTCATCGGAGCGAGAGGCCTCCCCGAGC

AACAGCTGCCAAGACTCCACAGATACAGAGAGCAACGCGGAGGAACAGCGCAGCGGCCTTATCTACCTAACCAACCACATCAACCCGCATGCACGCAATG

GGCTGGCTCTCAAGGAGGAGCAGCGCGCCTACGAGGTGCTGAGGGCGGCCTCAGAGAACTCGCAGGATGCCTTCCGTGTGGTCAGCACGAGTGGCGAGCA

GCTGAAGGTGTACAAGTGCGAACACTGCCGCGTGCTCTTCCTGGATCACGTCATGTATACCATTCACATGGGCTGCCATGGCTTTCGGGATCCCTTTGAG

TGTAACATGTGTGGTTATCACAGCCAGGACAGGTACGAGTTCTCATCCCATATCACGCGGGGGGAGCATCGTTACCACCTGAGCTAAACCCAGCCAGGCC

CCACTGAAGCACAAAGATAGCTGGTTATGCCTCCTTCCCGGCAGCTGGACCCACAGCGGACAATGTTGGGAGTGGATTTGCAGGCAGCATTTGTTCTTTT

ATGTTGGTTGTTTGGCGTTTGATTTGCGTTGGAAGATAAGTTTTTAATGTTAGTGACAGGATTGCATTGCATCAGGAACATTCACAACATCCATCCTTCT

AGCCAGTTTTGTTCACTGGTAGCTGAGGTTTCCCGGATATGTGGCTTCCTAACACTCTCCCCACCCACCCCACCCCCCAAAACAGAGCCTGAATCTTCAT

GAAGTGAATAAAACAATTATCCAAGAAGGAGTAAGGTGGATCTTGCCCTAAGCAGAGTTTATGCCACAAAGATTCTCCAAATCCCCCAAGACAGCACAGC

CACTGGGGTTGAGCCATCTCAGGGAGCTCTGCAGGTGAGCCAGAGGACCAGATATAAGGCAGCTGGGGAGGAGCAGGGACATCAGCCTGTGCAGAGACCA

AGGCCAAAGGTTGAACTTTGAAAGACTATTAAGTCATATATTGTATGGCAATATGGTGTCTGGACAAGTTGTGCAATGTGCTGAAGGGAAGGGATTGGAG

AGCCTTGAAGACTCTTCTTCATTTGCCTGATCAACCCGACCTCCAGAGGGTTTGTTGCCCAGTAAGACGAGCTCAGTGCTCTTGTGATCATTTTTCTCTT

ATCGTTTCCATGCCGTTGATGGCCCTGAAGCTCATCACTGCATTTTAGAACCCAATCCTGAAATTGGGACCTTTTTTTTAAACTTCTGATACTGTAAAAC

TTCTTGGAAGCCAAAGCTTTCTTCCAAGCCCCATCCTCAGTTATCCTGGTTCCTGTTCTTCCCCGAGCTGATAGTACCAGGACCTGTTATTCCACAAAAG

CACAGGCATCCGTCACTTCAATTCAATCCCTGTTCAGATTATAGATATGGACTTTGCTATCTTGATAAATGTCTTCTCTATGTTATTTTGTCTGAAAAAC

CTATAAAACCATTATTAAGAATGACCATTTTTAGATGGAAGAAATGAGCCCAGCATCTCAGTGGCTAAAACACAAAATATCCATGCTTTTAAACAAAATT

GTTAAATATTCCGAAGCTCTCTAGTATAAACACCAAGTAGCATGTGTTTTCACATAAAGAAGACAGGGGCCATGCAACCTTTATCAAGTGGAGGTATTAG

AATGTTGTAATGTTTGGAGACACAGTGTGACCAGTACAGGTTCCCAGAGAGGAATGCCCACCATATCACAGAAAGGTAGAGGTGGGATCTGGTATAGCCA

GACCAAGACAGGGATGTCACGCTGAAGCCAAGTCAGTTAGCTGAAGATTCTCAACAGGAAGGCCTCTCTTAAGAGTCAGTAATAGGGTTGTTACCATCCA

CCACCTCAACAAAACAAAAAGCTTATAATTGTAAATGTTTACAGCACTGTCTTCGCAGAAACTTTCTGAGGTGATTCCAAAGAACTAGAGGGGAGATGGT

CTATAACAGCTCTTGAAGTAAACGAGGTTCTTAGTCTCAGCTCTCCTGACATATAGGGCTTGATCATTACTGGTAGGGATTGTTCTGTGAATTGCTTACT

ACTACCCCTGGTCTCTCCCCAGTAGATGCCAGGAACATTCTAGCTGATACCTAACTGTCTTCCCAGGTGTTCGAGGGAGCAAACCACTGATCTAAACTCT

AAACGCTGAAGTACGCAGGTTTTCTAAAAATGACAAGCCCTTGAAACCTTTCCCAGTAGGCAGCCTCGAGCTGGACTTGTGTCTTTGGAATGCTGATGAA

TTCTATAGATCAGCATTGCAAATACACTTCAAATACGTCTGAGTTCAAGTGCAGGGACTGAGTTCACCAAGGTGTGAAATGTGCTCAAAAAGTTCAAAAG

TGTGTGTTTCTTTGTTTCTAAAACATTGTGGCATCTTTTTCATTTGTTTCTAAAACTTTTTTTTTAGAAACAAATGAAGCACTTGGAAAGTGAAAGTAAA

ATTACAAATATAAGGATTTACACTGAAGAGAGAAAAATTTTAGGAACTATAGCTGTGAAAAGATTTTGTTCAAAAGGCAGGCTAGCCTTACCCAAATTCA

TATATGGCAGGTGTCAACCTCCCAAGCTTACAGTTAGCAGGCAGCTTTTGCTCACTCATCCTTAGCCATGAGAGCCATTAAGTGTGGTCCAAGAAAGATG

GCTCCAAACCCTACCCCCGACCCACCAGTGGTATTCAGAGATTAAAGCAGAATTGTAAATAGTGGCTTCAGGAGCTCTTTTTTAGAATGCTTTGCCCCTT

CCTCTCACTGCCTTTTTTAGCCAATATAAATGTCAATTTGCACACCTTTTGTTGTGGTTTTATATTGTAACAGCATTTTTTTGAAACTATTGTATTTAAG

ATAAGGTTTCATATTATGTCCACAAGTAATTAAATTATGTTTGAAGGTGGCTATATGCT
Translation
 MDVDEGQDMSQVSG GKESPPVSDTPDEGDEPMPVPEDLSTTSGAQQNSKSDRGMV VAYGADGFRDFHAIIPKSFSP PSNVKVETQSDEENGRACEM

NGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIVCIGPNVLMVHKRSHTG GERPFQCNQCGASFTQKGNLLRHIKLHSGEK

PFKCHLCNYACRRRDALTGHLRTHSV VGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPGMYPV VIKEETNHNEMAEDLCKIGAERSLVLDRLA

SNVAKRKSSMPQKFLG - UNI30191 - GDKCLSDMPYDSANYEKEDMMTSHVMDQAINNAINYLGAESLRPLVQTPPGSSEVVPVISSMYQLHKPPS

DGPPRSNHSAQDAVDNLLLLSKAKSVSSEREASPSNSCQDSTDTESNAEEQRSGLIYLTNHINPHARNGLALKEEQRAYEVLRAASENSQDAFRVVSTSG

EQLKVYKCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSHITRGEHRYHLS
Transcript ENSMUST00000078183
Sequence
ATTTGTGTGGCAGAGAGAGACAGCTCTCGTTTGGCCTTGGGGAGGCACAAGTCTGTTG ATAACCTGAAGACAATGGATGTCGATGAGGGTCAAGACATG

TCCCAAGTTTCAG GAAAGGAGAGCCCCCCAGTCAGTGACACTCCAGATGAAGGGGATGAGCCCATGCCTGTCCCTGAGGACCTGTCCACTACCTCTGGA

GCACAGCAGAACTCCAAGAGTGATCGAGGCATGG CCAGTAATGTTAAAGTAGAGACTCAGAGTGATGAAGAGAATGGGCGTGCCTGTGAAATGAATGGG

GAAGAATGTGCAGAGGATTTACGAATGCTTGATGCCTCGGGAGAGAAAATGAATGGCTCCCACAGGGACCAAGGCAGCTCGGCTTTGTCAGGAGTTGGAG

GCATTCGACTTCCTAACGGAAAACTAAAGTGTGATATCTGTGGGATCGTTTGCATCGGGCCCAATGTGCTCATGGTTCACAAAAGAAGTCATACTG GTG

AACGGCCTTTCCAGTGCAACCAGTGTGGGGCCTCCTTTACCCAGAAAGGCAACCTCCTGCGGCACATCAAGCTGCACTCGGGTGAGAAGCCCTTCAAATG

CCATCTTTGCAACTATGCCTGCCGCCGGAGGGACGCCCTCACCGGCCACCTGAGGACGCACTCCG TTGGTAAGCCTCACAAATGTGGATATTGTGGCCG

GAGCTATAAACAGCGAAGCTCTTTAGAGGAGCATAAAGAGCGATGCCACAACTACTTGGAAAGCATGGGCCTTCCGGGCATGTACCCAG TCATTAAGGA

AGAAACTAACCACAACGAGATGGCAGAAGACCTGTGCAAGATAGGAGCAGAGAGGTCCCTTGTCCTGGACAGGCTGGCAAGCAATGTCGCCAAACGTAAG

AGCTCTATGCCTCAGAAATTTCTTG - UNI30191 - GAGACAAGTGCCTGTCAGACATGCCCTATGACAGTGCCAACTATGAGAAGGAGGATATGAT

GACATCCCACGTGATGGACCAGGCCATCAACAATGCCATCAACTACCTGGGGGCTGAGTCCCTGCGCCCATTGGTGCAGACACCCCCCGGTAGCTCCGAG

GTGGTGCCAGTCATCAGCTCCATGTACCAGCTGCACAAGCCCCCCTCAGATGGCCCCCCACGGTCCAACCATTCAGCACAGGACGCCGTGGATAACTTGC

TGCTGCTGTCCAAGGCCAAGTCTGTGTCATCGGAGCGAGAGGCCTCCCCGAGCAACAGCTGCCAAGACTCCACAGATACAGAGAGCAACGCGGAGGAACA

GCGCAGCGGCCTTATCTACCTAACCAACCACATCAACCCGCATGCACGCAATGGGCTGGCTCTCAAGGAGGAGCAGCGCGCCTACGAGGTGCTGAGGGCG

GCCTCAGAGAACTCGCAGGATGCCTTCCGTGTGGTCAGCACGAGTGGCGAGCAGCTGAAGGTGTACAAGTGCGAACACTGCCGCGTGCTCTTCCTGGATC

ACGTCATGTATACCATTCACATGGGCTGCCATGGCTTTCGGGATCCCTTTGAGTGTAACATGTGTGGTTATCACAGCCAGGACAGGTACGAGTTCTCATC

CCATATCACGCGGGGGGAGCATCGTTACCACCTGAGCTAAACCCAGCCAGGCCCCACTGAAGCACAAAGATAGCTGGTTATGCCTCCTTCCCGGCAGCTG

GACCCACAGCGGACAATGTTGGGAGTGGATTTGCAGGCAGCATTTGTTCTTTTATGTTGGTTGTTTGGCGTTTGATTTGCGTTGGAAGATAAGTTTTTAA

TGTTAGTGACAGGATTGCATTGCATCAGGAACATTCACAACATCCATCCTTCTAGCCAGTTTTGTTCACTGGTAGCTGAGGTTTCCCGGATATGTGGCTT

CCTAACACTCTCCCCACCCACCCCACCCCCCAAAACAGAGCCTGAATCTTCATGAAGTGAATAAAACAATTATCCAAGAAGGAGTAAGGTGGATCTTGCC

CTAAGCAGAGTTTATGCCACAAAGATTCTCCAAATCCCCCAAGACAGCACAGCCACTGGGGTTGAGCCATCTCAGGGAGCTCTGCAGGTGAGCCAGAGGA

CCAGATATAAGGCAGCTGGGGAGGAGCAGGGACATCAGCCTGTGCAGAGACCAAGGCCAAAGGTTGAACTTTGAAAGACTATTAAGTCATATATTGTATG

GCAATATGGTGTCTGGACAAGTTGTGCAATGTGCTGAAGGGAAGGGATTGGAGAGCCTTGAAGACTCTTCTTCATTTGCCTGATCAACCCGACCTCCAGA

GGGTTTGTTGCCCAGTAAGACGAGCTCAGTGCTCTTGTGATCATTTTTCTCTTATCGTTTCCATGCCGTTGATGGCCCTGAAGCTCATCACTGCATTTTA

GAACCCAATCCTGAAATTGGGACCTTTTTTTTAAACTTCTGATACTGTAAAACTTCTTGGAAGCCAAAGCTTTCTTCCAAGCCCCATCCTCAGTTATCCT

GGTTCCTGTTCTTCCCCGAGCTGATAGTACCAGGACCTGTTATTCCACAAAAGCACAGGCATCCGTCACTTCAATTCAATCCCTGTTCAGATTATAGATA

TGGACTTTGCTATCTTGATAAATGTCTTCTCTATGTTATTTTGTCTGAAAAACCTATAAAACCATTATTAAGAATGACCATTTTTAGATGGAAGAAATGA

GCCCAGCATCTCAGTGGCTAAAACACAAAATATCCATGCTTTTAAACAAAATTGTTAAATATTCCGAAGCTCTCTAGTATAAACACCAAGTAGCATGTGT

TTTCACATAAAGAAGACAGGGGCCATGCAACCTTTATCAAGTGGAGGTATTAGAATGTTGTAATGTTTGGAGACACAGTGTGACCAGTACAGGTTCCCAG

AGAGGAATGCCCACCATATCACAGAAAGGTAGAGGTGGGATCTGGTATAGCCAGACCAAGACAGGGATGTCACGCTGAAGCCAAGTCAGTTAGCTGAAGA

TTCTCAACAGGAAGGCCTCTCTTAAGAGTCAGTAATAGGGTTGTTACCATCCACCACCTCAACAAAACAAAAAGCTTATAATTGTAAATGTTTACAGCAC

TGTCTTCGCAGAAACTTTCTGAGGTGATTCCAAAGAACTAGAGGGGAGATGGTCTATAACAGCTCTTGAAGTAAACGAGGTTCTTAGTCTCAGCTCTCCT

GACATATAGGGCTTGATCATTACTGGTAGGGATTGTTCTGTGAATTGCTTACTACTACCCCTGGTCTCTCCCCAGTAGATGCCAGGAACATTCTAGCTGA

TACCTAACTGTCTTCCCAGGTGTTCGAGGGAGCAAACCACTGATCTAAACTCTAAACGCTGAAGTACGCAGGTTTTCTAAAAATGACAAGCCCTTGAAAC

CTTTCCCAGTAGGCAGCCTCGAGCTGGACTTGTGTCTTTGGAATGCTGATGAATTCTATAGATCAGCATTGCAAATACACTTCAAATACGTCTGAGTTCA

AGTGCAGGGACTGAGTTCACCAAGGTGTGAAATGTGCTCAAAAAGTTCAAAAGTGTGTGTTTCTTTGTTTCTAAAACATTGTGGCATCTTTTTCATTTGT

TTCTAAAACTTTTTTTTTAGAAACAAATGAAGCACTTGGAAAGTGAAAGTAAAATTACAAATATAAGGATTTACACTGAAGAGAGAAAAATTTTAGGAAC

TATAGCTGTGAAAAGATTTTGTTCAAAAGGCAGGCTAGCCTTACCCAAATTCATATATGGCAGGTGTCAACCTCCCAAGCTTACAGTTAGCAGGCAGCTT

TTGCTCACTCATCCTTAGCCATGAGAGCCATTAAGTGTGGTCCAAGAAAGATGGCTCCAAACCCTACCCCCGACCCACCAGTGGTATTCAGAGATTAAAG

CAGAATTGTAAATAGTGGCTTCAGGAGCTCTTTTTTAGAATGCTTTGCCCCTTCCTCTCACTGCCTTTTTTAGCCAATATAAATGTCAATTTGCACACCT

TTTGTTGTGGTTTTATATTGTAACAGCATTTTTTTGAAACTATTGTATTTAAGATAAGGTTTCATATTATGTCCACAAGTAATTAAATTATGTTTGAAGG

TGGCTATATGCT
Translation
ICVAERDSSRLALGRHKSVD DNLKTMDVDEGQDMSQVSG GKESPPVSDTPDEGDEPMPVPEDLSTTSGAQQNSKSDRGMA ASNVKVETQSDEENGRA

CEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIVCIGPNVLMVHKRSHTG GERPFQCNQCGASFTQKGNLLRHIKLHS

GEKPFKCHLCNYACRRRDALTGHLRTHSV VGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPGMYPV VIKEETNHNEMAEDLCKIGAERSLVLD

RLASNVAKRKSSMPQKFLG - UNI30191 - GDKCLSDMPYDSANYEKEDMMTSHVMDQAINNAINYLGAESLRPLVQTPPGSSEVVPVISSMYQLHK

PPSDGPPRSNHSAQDAVDNLLLLSKAKSVSSEREASPSNSCQDSTDTESNAEEQRSGLIYLTNHINPHARNGLALKEEQRAYEVLRAASENSQDAFRVVS

TSGEQLKVYKCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSHITRGEHRYHLS

For any suggestions or comments, please send an email to unitrap@crg.es