Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000018678 (Sp2)
Chromosomal location
Chr 11: 96814654 - 96844273 (-)
Description
Sp2 transcription factor Gene [Source:MGI (curated);Acc:Sp2-001]
RefSeq_dna
NM_030220 
RefSeq_peptide
NP_001074433.1 NP_084496.2 
UniGene
Mm.475678 Mm.155547 
MGI
MGI:1926162 
Uniprot/SWISSPROT
Q9D2H6 
Uniprot/SPTREMBL
Q3U0T7 Q3UTN3 Q8BNQ4 Q8C5J0 
Human Ortholog
ENSG00000167182 (SP2)
Omim not available
UniTrap UNI30762
Vector Insertion
Chr 11: 96838934 - 96842900
Public Clones (sanger) IST15014C6 (tigm) IST13838D2 (tigm) IST14546C5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5311
Vector Insertion
Chr 11: 96829980 - 96838934
Public Clones (sanger) YTA156 (baygenomics) XC297 (baygenomics) SYA303 (baygenomics)
3SD001E05 (ggtc) P013A07 (ggtc) 3SD071D07 (ggtc) P016D04 (ggtc)
3SD072C08 (ggtc) 5SE086F09 (ggtc) D001E05 (ggtc) 5SD071D07 (ggtc)
PST9419-NR (escells) IST14482G2 (tigm) IST14414D8 (tigm) IST14503D8 (tigm)
IST13780G9 (tigm) IST14142E6 (tigm) IST10029E2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15411
Vector Insertion
Chr 11: 96824678 - 96829980
Public Clones (sanger) PST8047-NL (escells) IST14855B12 (tigm) IST14628B11 (tigm)
IST10809C8 (tigm) IST11583D2 (tigm)
Private Clones OST464743 (lexicon) OST462664 (lexicon) OST455043 (lexicon) OST437285 (lexicon)
OST416094 (lexicon) OST414545 (lexicon) OST363330 (lexicon) OST360119 (lexicon)
OST318273 (lexicon) OST302171 (lexicon) OST278303 (lexicon) OST278060 (lexicon)
OST214307 (lexicon) OST210091 (lexicon) OST201971 (lexicon) OST192953 (lexicon)
OST190391 (lexicon) OST187213 (lexicon) OST155321 (lexicon) OST148559 (lexicon)
OST124589 (lexicon) OST68108 (lexicon) OST66087 (lexicon) OST59532 (lexicon)
OST41394 (lexicon) OST41385 (lexicon) OST30538 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20078
Vector Insertion
Chr 11: 96824678 - 96824756
Public Clones not available
Private Clones OST373643 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17944
Vector Insertion
Chr 11: 96823324 - 96824678
Public Clones (sanger) IST14381A2 (tigm) IST14153H8 (tigm)
Private Clones OST432971 (lexicon) OST429937 (lexicon) OST376642 (lexicon) OST376604 (lexicon)
OST354489 (lexicon) OST329782 (lexicon) OST302223 (lexicon) OST277317 (lexicon)
OST208965 (lexicon) OST148163 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22063
Vector Insertion
Chr 11: 96817283 - 96817418
Public Clones IST11905D2 (tigm)
Private Clones OST309929 (lexicon)
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6798
Vector Insertion
Chr 11: 96815885 - 96817088
Public Clones RHA041 (baygenomics) (ggtc)
Private Clones OST44823 (lexicon) OST40030 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107626
Sequence
GGGCGGTGTCAGGCTCTCGGTGGCGGCGGAGGCGGCGGAGGCCAGGGAGGAAGATGTCGTAATGAGCG - UNI5311 - - UNI15411 - - UNI3

0762 - CAGATCCACAGATGAGCATGGCCGCCACTGCTGCTGTCAGTCCCAGTGACTACCTGCAGCCTGCTGCTGCTACTACCCAG - UNI15411 -

 - UNI17944 - - UNI20078 - GACTCCCAGCCATCTCCCTTGGCCCTGCTTGCTGCGACATGTAGCAAAATTGGCCCCCCAGCTGTTGAAGCTG

CAGTGACACCTCCTGCTCCCCCCCAGCCTACCCCAAGGAAACTGGTCCCTATCAAACCCGCTCCTCTCCCTCTCAGTCCCTGCAAGAATAGCTTTAGCAT

CTTATCATCTAAAGGAAATATACTTCAGATTCAGGGCTCCCAGCTGAGTACCTCCTACCCTGGAGGGCAGTTTGTGTTTGCAATCCAGAACCCCACCCTG

ATCAACAAAGGGAGCCGATCAAATGCAAGTATCCAGTACCAAGTCCCTCAGATCCAAGGGAACAGTTCCCAGACCATCCAGGTGCAGCCCAGTCTCACCA

ACCAGATCCAGGTCATCCCAGGCACCAACCAAGCCATCACCACCCCGTCAACATCTGGTCATAAGCCTGTCCCCATCAAGCCAGCTCCTGTCCAGAAGTC

AAGTACGACTACCACCCCTGTGCAGAGCGGGGCCAACGTGGTGAAGCTGACAGGCGGGGGTAGCAACATGACGCTCACCCTGCCGCTCAACAACCTGGTG

AACACCAGCGATATTGGGGGCCCTGCTCAGCTCCTCACTGAGAGCCCCCCCACCCCACTGTCTAAGACTAACAAGAAAGCTAGGAAGAAGAGCCTCCCTG

TGTCACAGCCATCCGTAGCTGTGGCTGAGCAGGTGGAGACGGTGCTGATAGAGACCACGGCAGACAACATCATCCAGGCAGGAAACAACCTGCTGATCGT

CCAGAGCCCTGGCGGGGGCCAGCCAGCTGTGGTCCAGCAAGTCCAGGTGGTGCCACCCAAGGCTGAGCAGCAGCAGGTGGTCCAGATCCCCCAGCAGGCA

CTGCGGGTGGTGCAAGCTGCCTCTGCCACCCTCCCCACCGTCCCCCAGAAGCCCTCTCAGAACTTTCAGATCCAGACAACTGAACCAACACCAACCCAG 

GTTTATATCCGTACACCTTCTGGTGAGGTACAGACAGTCCTTGTCCAGGACAGCCCCCCAGCAACAGCTGCAACCACATCAACCGTCACCTGTAACAGCC

CTGCACTCCGAGCTCCCCATCTGAGTGGCACCAGCAAAAAACATTCAGCTGCCATTCTCCGAAAAGAGCGGCCCCTGCCAAAGATTGCACCTGCTGGGAG

CATCATCAGCCTGAACGCCGCACAGCTGGCAGCAGCTGCTCAGGCCATGCAGACCATCAACATCAATGGTGTCCAAGTCCAGGGTGTGCCTGTCACCATC

ACCAACACTGGCG GGCAGCAGCAGCTGACCGTGCAGAACGTTTCTGGAAACAACCTGACTATCAGTGGGCTGAGCCCCACCCAGATCCAGCTGCAGATG

GAGCAGGCTCTAGCCGGAGAGGCCCAGCCTGGGGAGAAACGGCGGCGCATGGCCTGCACGTGTCCCAACTGCAAGGATGGGGAGAAGAG - UNI22063

 - GTCTGGGGAGCAGGGCAAGAAGAAGCACGTGTGCCACATCCCGGACTGCGGGAAGACTTTCCGGAAGACATCCTTGCTCCGGGCCCACGTCCGCCTG

CACACTGGCGAGCGGCCCTTTGTCTGCAACTGGTTCTTCTGTGGAAAGAGATTCACTCGGAGCGATGAACTCCAGCGACATGCTCGAACCCACACAG - 

UNI6798 - GGGACAAGCGCTTTGAGTGTGCCCAATGTCAGAAGCGCTTCATGAGGAGTGACCACCTCACCAAGCATTACAAGACCCACCTAGGCACGA

AGGGCTTGTAAGGCCAACTGAGGCAGGAGGCCCTGAAGATGGAACACCTCCCATCTGATTGGCCCTGGGTCCATGATGGACAGGTGCCCACGACTGCCCT

GGGCAGCCCTCACCCCACTCCTGTTCTGTGGCTGTGTCCCTGCAGAGAGGGACTCTGTTCCTGTGTTCTCCTCCTTCCAAAGGCTCTGCCCCTCTCACCG

TGAGCTCCTGGCCTGCCCAGGCCATGGACACTGGCCATGCCCAATGAGACGTTCTAACCCAGGACGCGTGGGGACCCTTATTTCCAAAGGAAAAACATAC

ATTTCACTCCGTCGAGGAGCAAAGTGAGCCCCCATCCCCACCCCATCCCCTTCCTCAACACTGCCGGAGTCCCATTGTGCCATGCCCCCTCCCCCACCGT

GCCTCCTTGTCCCCCTCAATTAAGTCCTCCTGGGCCGCTAGGGACACCCAGGGGCCCTGTACCCAGCCTCCCACTGACACCCCCCACCGGGGAGGTGGGA

GGCTGCCTCCACTCCACTGCCCAGCCCTGCCACGGCTCTCCTCCAAACATTCCAACTTCCTATGAAAGGTCAGACGCCGAGGACCTGCCCTCCCTCTTTT

CTACGGAGAACGTTGCCTTATACTCACTTCAGATGATGACACTGTGGACGTGTGTGCTTTAACCACATTTTATTTAATTGCTCCCTTCCTCTCTTTGCTA

GACGCCTCCCCCTTGCTTGCATTCAGTTTAGGGTTTTGGGGGCAATGCTGAGCATAGGAGGGTCTTTTTTTTTTTGCTATTTTTTTTCTCACTTTAACAA

TTCTTTTCTAAATGACACATTTCAACTCAAATCTGGACTCACCTGAGAACACCTTCCATCCTGACCCCGCCACGCCCTCATCTCCCCCTGCCCAAGCTCC

ACTGTGTACAGTGTATATTGTATAATAGACTATTGTGTCTAAGACATGTTTTAAAAACATATTGCTTGTTATTTTTGAGGCTTTTAAATTAAACAGAAAT

CCAACTTTATTTTCGTTGTAACTGCTTGAGGATGTTTTATTAATTAAGTGAAGATTTGTTATCCTTTATTAACGATGTATTTTGTTGGTCAGTACTGGGC

TGACAAAAAGTTTCTTGCTAATAAATTTAGTTGCCCAAGGC
Translation
MSA - UNI5311 - - UNI15411 - - UNI30762 - ADPQMSMAATAAVSPSDYLQPAAATTQ - UNI15411 - - UNI17944 - - UN

I20078 - DSQPSPLALLAATCSKIGPPAVEAAVTPPAPPQPTPRKLVPIKPAPLPLSPCKNSFSILSSKGNILQIQGSQLSTSYPGGQFVFAIQNPTL

INKGSRSNASIQYQVPQIQGNSSQTIQVQPSLTNQIQVIPGTNQAITTPSTSGHKPVPIKPAPVQKSSTTTTPVQSGANVVKLTGGGSNMTLTLPLNNLV

NTSDIGGPAQLLTESPPTPLSKTNKKARKKSLPVSQPSVAVAEQVETVLIETTADNIIQAGNNLLIVQSPGGGQPAVVQQVQVVPPKAEQQQVVQIPQQA

LRVVQAASATLPTVPQKPSQNFQIQTTEPTPTQ VYIRTPSGEVQTVLVQDSPPATAATTSTVTCNSPALRAPHLSGTSKKHSAAILRKERPLPKIAPAG

SIISLNAAQLAAAAQAMQTININGVQVQGVPVTITNTGG GQQQLTVQNVSGNNLTISGLSPTQIQLQMEQALAGEAQPGEKRRRMACTCPNCKDGEKR 

- UNI22063 - RSGEQGKKKHVCHIPDCGKTFRKTSLLRAHVRLHTGERPFVCNWFFCGKRFTRSDELQRHARTHTG - UNI6798 - GDKRFECA

QCQKRFMRSDHLTKHYKTHLGTKGL
Transcript ENSMUST00000107624
Sequence
TCCGGGATTGGCGGGTGCTAGGCGGGCGGTGTCAGGCTCTCGGTGGCGGCGGAGGCGGCGGAGGCCAGGGAGGAAGATGTCGTAATGAGCG - UNI531

1 - - UNI15411 - - UNI30762 - CAGATCCACAGATGAGCATGGCCGCCACTGCTGCTGTCAGTCCCAGTGACTACCTGCAGCCTGCTGCTGC

TACTACCCAG - UNI15411 - - UNI17944 - - UNI20078 - GACTCCCAGCCATCTCCCTTGGCCCTGCTTGCTGCGACATGTAGCAAAAT

TGGCCCCCCAGCTGTTGAAGCTGCAGTGACACCTCCTGCTCCCCCCCAGCCTACCCCAAGGAAACTGGTCCCTATCAAACCCGCTCCTCTCCCTCTCAGT

CCCTGCAAGAATAGCTTTAGCATCTTATCATCTAAAGGAAATATACTTCAGATTCAGGGCTCCCAGCTGAGTACCTCCTACCCTGGAGGGCAGTTTGTGT

TTGCAATCCAGAACCCCACCCTGATCAACAAAGGGAGCCGATCAAATGCAAGTATCCAGTACCAAGTCCCTCAGATCCAAGGGAACAGTTCCCAGACCAT

CCAGGTGCAGCCCAGTCTCACCAACCAGATCCAGGTCATCCCAGGCACCAACCAAGCCATCACCACCCCGTCAACATCTGGTCATAAGCCTGTCCCCATC

AAGCCAGCTCCTGTCCAGAAGTCAAGTACGACTACCACCCCTGTGCAGAGCGGGGCCAACGTGGTGAAGCTGACAGGCGGGGGTAGCAACATGACGCTCA

CCCTGCCGCTCAACAACCTGGTGAACACCAGCGATATTGGGGGCCCTGCTCAGCTCCTCACTGAGAGCCCCCCCACCCCACTGTCTAAGACTAACAAGAA

AGCTAGGAAGAAGAGCCTCCCTGTGTCACAGCCATCCGTAGCTGTGGCTGAGCAGGTGGAGACGGTGCTGATAGAGACCACGGCAGACAACATCATCCAG

GCAGGAAACAACCTGCTGATCGTCCAGAGCCCTGGCGGGGGCCAGCCAGCTGTGGTCCAGCAAGTCCAGGTGGTGCCACCCAAGGCTGAGCAGCAGCAGG

TGGTCCAGATCCCCCAGCAGGCACTGCGGGTGGTGCAAGCTGCCTCTGCCACCCTCCCCACCGTCCCCCAGAAGCCCTCTCAGAACTTTCAGATCCAGAC

AACTGAACCAACACCAACCCAG GTTTATATCCGTACACCTTCTGGTGAGGTACAGACAGTCCTTGTCCAGGACAGCCCCCCAGCAACAGCTGCAACCAC

ATCAACCGTCACCTGTAACAGCCCTGCACTCCGAGCTCCCCATCTGAGTGGCACCAGCAAAAAACATTCAGCTGCCATTCTCCGAAAAGAGCGGCCCCTG

CCAAAGATTGCACCTGCTGGGAGCATCATCAGCCTGAACGCCGCACAGCTGGCAGCAGCTGCTCAGGCCATGCAGACCATCAACATCAATGGTGTCCAAG

TCCAGGGTGTGCCTGTCACCATCACCAACACTGGCG GGCAGCAGCAGCTGACCGTGCAGAACGTTTCTGGAAACAACCTGACTATCAGTGGGCTGAGCC

CCACCCAGATCCAGCTGCAGATGGAGCAGGCTCTAGCCGGAGAGGCCCAGCCTGGGGAGAAACGGCGGCGCATGGCCTGCACGTGTCCCAACTGCAAGGA

TGGGGAGAAGAG - UNI22063 - GTCTGGGGAGCAGGGCAAGAAGAAGCACGTGTGCCACATCCCGGACTGCGGGAAGACTTTCCGGAAGACATCCT

TGCTCCGGGCCCACGTCCGCCTGCACACTGGCGAGCGGCCCTTTGTCTGCAACTGGTTCTTCTGTGGAAAGAGATTCACTCGGAGCGATGAACTCCAGCG

ACATGCTCGAACCCACACAG - UNI6798 - GGGACAAGCGCTTTGAGTGTGCCCAATGTCAGAAGCGCTTCATGAGGAGTGACCACCTCACCAAGCA

TTACAAGACCCACCTAGGCACGAAGGGCTTGTAAGGCCAACTGAGGCAGGAGGCCCTGAAGATGGAACACCTCCCATCTGATTGGCCCTGGGTCCATGAT

GGACAGGTGCCCACGACTGCCCTGGGCAGCCCTCACCCCACTCCTGTTCTGTGGCTGTGTCCCTGCAGAGAGGGACTCTGTTCCTGTGTTCTCCTCCTTC

CAAAGGCTCTGCCCCTCTCACCGTGAGCTCCTGGCCTGCCCAGGCCATGGACACTGGCCATGCCCAATGAGACGTTCTAACCCAGGACGCGTGGGGACCC

TTATTTCCAAAGGAAAAACATACATTTCACTCCGTCGAGGAGCAAAGTGAGCCCCCATCCCCACCCCATCCCCTTCCTCAACACTGCCGGAGTCCCATTG

TGCCATGCCCCCTCCCCCACCGTGCCTCCTTGTCCCCCTCAATTAAGTCCTCCTGGGCCGCTAGGGACACCCAGGGGCCCTGTACCCAGCCTCCCACTGA

CACCCCCCACCGGGGAGGTGGGAGGCTGCCTCCACTCCACTGCCCAGCCCTGCCACGGCTCTCCTCCAAACATTCCAACTTCCTATGAAAGGTCAGACGC

CGAGGACCTGCCCTCCCTCTTTTCTACGGAGAACGTTGCCTTATACTCACTTCAGATGATGACACTGTGGACGTGTGTGCTTTAACCACATTTTATTTAA

TTGCTCCCTTCCTCTCTTTGCTAGACGCCTCCCCCTTGCTTGCATTCAGTTTAGGGTTTTGGGGGCAATGCTGAGCATAGGAGGGTCTTTTTTTTTTTGC

TATTTTTTTTCTCACTTTAACAATTCTTTTCTAAATGACACATTTCAACTCAAATCTGGACTCACCTGAGAACACCTTCCATCCTGACCCCGCCACGCCC

TCATCTCCCCCTGCCCAAGCTCCACTGTGTACAGTGTATATTGTATAATAGACTATTGTGTCTAAGACATGTTTTAAAAACATATTGCTTGTTATTTTTG

AGGCTTTTAAATTAAACAGAAATCCAACTTTATTTTCGTTGTAACTGCTTGAGGATGTTTTATTAATTAAGTGAAGATTTGTTATCCTTTATTAACGATG

TATTTTGTTGGTCAGTACTGGGCTGACAAAAAGTTTCTTGCTAATAAATTTAGTTGCCCAAGG
Translation
 - UNI5311 - - UNI15411 - - UNI30762 - MSMAATAAVSPSDYLQPAAATTQ - UNI15411 - - UNI17944 - - UNI20078 

- DSQPSPLALLAATCSKIGPPAVEAAVTPPAPPQPTPRKLVPIKPAPLPLSPCKNSFSILSSKGNILQIQGSQLSTSYPGGQFVFAIQNPTLINKGSRS

NASIQYQVPQIQGNSSQTIQVQPSLTNQIQVIPGTNQAITTPSTSGHKPVPIKPAPVQKSSTTTTPVQSGANVVKLTGGGSNMTLTLPLNNLVNTSDIGG

PAQLLTESPPTPLSKTNKKARKKSLPVSQPSVAVAEQVETVLIETTADNIIQAGNNLLIVQSPGGGQPAVVQQVQVVPPKAEQQQVVQIPQQALRVVQAA

SATLPTVPQKPSQNFQIQTTEPTPTQ VYIRTPSGEVQTVLVQDSPPATAATTSTVTCNSPALRAPHLSGTSKKHSAAILRKERPLPKIAPAGSIISLNA

AQLAAAAQAMQTININGVQVQGVPVTITNTGG GQQQLTVQNVSGNNLTISGLSPTQIQLQMEQALAGEAQPGEKRRRMACTCPNCKDGEKR - UNI22

063 - RSGEQGKKKHVCHIPDCGKTFRKTSLLRAHVRLHTGERPFVCNWFFCGKRFTRSDELQRHARTHTG - UNI6798 - GDKRFECAQCQKRFM

RSDHLTKHYKTHLGTKGL
Transcript ENSMUST00000107623
Sequence
ACAGCCCTGGGAGCGAGCCTGTGGAAGCAGTCTGAAGCCACGTGAACAGACACAGTCCCCCAAGGAAAGAGGTCTTGG - UNI15411 - - UNI200

78 - ATCCACAGATGAGCATGGCCGCCACTGCTGCTGTCAGTCCCAGTGACTACCTGCAGCCTGCTGCTGCTACTACCCAG - UNI15411 - - UN

I17944 - - UNI20078 - GACTCCCAGCCATCTCCCTTGGCCCTGCTTGCTGCGACATGTAGCAAAATTGGCCCCCCAGCTGTTGAAGCTGCAGTG

ACACCTCCTGCTCCCCCCCAGCCTACCCCAAGGAAACTGGTCCCTATCAAACCCGCTCCTCTCCCTCTCAGTCCCTGCAAGAATAGCTTTAGCATCTTAT

CATCTAAAGGAAATATACTTCAGATTCAGGGCTCCCAGCTGAGTACCTCCTACCCTGGAGGGCAGTTTGTGTTTGCAATCCAGAACCCCACCCTGATCAA

CAAAGGGAGCCGATCAAATGCAAGTATCCAGTACCAAGTCCCTCAGATCCAAGGGAACAGTTCCCAGACCATCCAGGTGCAGCCCAGTCTCACCAACCAG

ATCCAGGTCATCCCAGGCACCAACCAAGCCATCACCACCCCGTCAACATCTGGTCATAAGCCTGTCCCCATCAAGCCAGCTCCTGTCCAGAAGTCAAGTA

CGACTACCACCCCTGTGCAGAGCGGGGCCAACGTGGTGAAGCTGACAGGCGGGGGTAGCAACATGACGCTCACCCTGCCGCTCAACAACCTGGTGAACAC

CAGCGATATTGGGGGCCCTGCTCAGCTCCTCACTGAGAGCCCCCCCACCCCACTGTCTAAGACTAACAAGAAAGCTAGGAAGAAGAGCCTCCCTGTGTCA

CAGCCATCCGTAGCTGTGGCTGAGCAGGTGGAGACGGTGCTGATAGAGACCACGGCAGACAACATCATCCAGGCAGGAAACAACCTGCTGATCGTCCAGA

GCCCTGGCGGGGGCCAGCCAGCTGTGGTCCAGCAAGTCCAGGTGGTGCCACCCAAGGCTGAGCAGCAGCAGGTGGTCCAGATCCCCCAGCAGGCACTGCG

GGTGGTGCAAGCTGCCTCTGCCACCCTCCCCACCGTCCCCCAGAAGCCCTCTCAGAACTTTCAGATCCAGACAACTGAACCAACACCAACCCAG GTTTA

TATCCGTACACCTTCTGGTGAGGTACAGACAGTCCTTGTCCAGGACAGCCCCCCAGCAACAGCTGCAACCACATCAACCGTCACCTGTAACAGCCCTGCA

CTCCGAGCTCCCCATCTGAGTGGCACCAGCAAAAAACATTCAGCTGCCATTCTCCGAAAAGAGCGGCCCCTGCCAAAGATTGCACCTGCTGGGAGCATCA

TCAGCCTGAACGCCGCACAGCTGGCAGCAGCTGCTCAGGCCATGCAGACCATCAACATCAATGGTGTCCAAGTCCAGGGTGTGCCTGTCACCATCACCAA

CACTGGCG GGCAGCAGCAGCTGACCGTGCAGAACGTTTCTGGAAACAACCTGACTATCAGTGGGCTGAGCCCCACCCAGATCCAGCTGCAGATGGAGCA

GGCTCTAGCCGGAGAGGCCCAGCCTGGGGAGAAACGGCGGCGCATGGCCTGCACGTGTCCCAACTGCAAGGATGGGGAGAAGAG - UNI22063 - GT

CTGGGGAGCAGGGCAAGAAGAAGCACGTGTGCCACATCCCGGACTGCGGGAAGACTTTCCGGAAGACATCCTTGCTCCGGGCCCACGTCCGCCTGCACAC

TGGCGAGCGGCCCTTTGTCTGCAACTGGTTCTTCTGTGGAAAGAGATTCACTCGGAGCGATGAACTCCAGCGACATGCTCGAACCCACACAG - UNI67

98 - GGGACAAGCGCTTTGAGTGTGCCCAATGTCAGAAGCGCTTCATGAGGAGTGACCACCTCACCAAGCATTACAAGACCCACCTAGGCACGAAGGGC

TTGTAAGGCCAACTGAGGCAGGAGGCCCTGAAGATGGAACACCTCCCATCTGATTGGCCCTGGGTCCATGATGGACAGGTGCCCACGACTGCCCTGGGCA

GCCCTCACCCCACTCCTGTTCTGTGGCTGTGTCCCTGCAGAGAGGGACTCTGTTCCTGTGTTCTCCTCCTTCCAAAGGCTCTGCCCCTCTCACCGTGAGC

TCCTGGCCTGCCCAGGCCATGGACACTGGCCATGCCCAATGAGACGTTCTAACCCAGGACGCGTGGGGACCCTTATTTCCAAAGGAAAAACATACATTTC

ACTCCGTCGAGGAGCAAAGTGAGCCCCCATCCCCACCCCATCCCCTTCCTCAACACTGCCGGAGTCCCATTGTGCCATGCCCCCTCCCCCACCGTGCCTC

CTTGTCCCCCTCAATTAAGTCCTCCTGGGCCGCTAGGGACACCCAGGGGCCCTGTACCCAGCCTCCCACTGACACCCCCCACCGGGGAGGTGGGAGGCTG

CCTCCACTCCACTGCCCAGCCCTGCCACGGCTCTCCTCCAAACATTCCAACTTCCTATGAAAGGTCAGACGCCGAGGACCTGCCCTCCCTCTTTTCTACG

GAGAACGTTGCCTTATACTCACTTCAGATGATGACACTGTGGACGTGTGTGCTTTAACCACATTTTATTTAATTGCTCCCTTCCTCTCTTTGCTAGACGC

CTCCCCCTTGCTTGCATTCAGTTTAGGGTTTTGGGGGCAATGCTGAGCATAGGAGGGTCTTTTTTTTTTTGCTATTTTTTTTCTCACTTTAACAATTCTT

TTCTAAATGACACATTTCAACTCAAATCTGGACTCACCTGAGAACACCTTCCATCCTGACCCCGCCACGCCCTCATCTCCCCCTGCCCAAGCTCCACTGT

GTACAGTGTATATTGTATAATAGACTATTGTGTCTAAGACATGTTTTAAAAACATATTGCTTGTTATTTTTGAGGCTTTTAAATTAAACAGAAATCCAAC

TTT
Translation
 - UNI15411 - - UNI20078 - MSMAATAAVSPSDYLQPAAATTQ - UNI15411 - - UNI17944 - - UNI20078 - DSQPSPLALL

AATCSKIGPPAVEAAVTPPAPPQPTPRKLVPIKPAPLPLSPCKNSFSILSSKGNILQIQGSQLSTSYPGGQFVFAIQNPTLINKGSRSNASIQYQVPQIQ

GNSSQTIQVQPSLTNQIQVIPGTNQAITTPSTSGHKPVPIKPAPVQKSSTTTTPVQSGANVVKLTGGGSNMTLTLPLNNLVNTSDIGGPAQLLTESPPTP

LSKTNKKARKKSLPVSQPSVAVAEQVETVLIETTADNIIQAGNNLLIVQSPGGGQPAVVQQVQVVPPKAEQQQVVQIPQQALRVVQAASATLPTVPQKPS

QNFQIQTTEPTPTQ VYIRTPSGEVQTVLVQDSPPATAATTSTVTCNSPALRAPHLSGTSKKHSAAILRKERPLPKIAPAGSIISLNAAQLAAAAQAMQT

ININGVQVQGVPVTITNTGG GQQQLTVQNVSGNNLTISGLSPTQIQLQMEQALAGEAQPGEKRRRMACTCPNCKDGEKR - UNI22063 - RSGEQG

KKKHVCHIPDCGKTFRKTSLLRAHVRLHTGERPFVCNWFFCGKRFTRSDELQRHARTHTG - UNI6798 - GDKRFECAQCQKRFMRSDHLTKHYKTH

LGTKGL
Transcript ENSMUST00000062652
Sequence
ATGCTTGCTTAGTGAGGGCTAAAGGCTTTTAGTCCAGGGATGACCCTGGTCTGCTGTGGGAAGCCTGGACTCGAGAAGCCTGATGGCTCCATGGAAATGT

GCTCATG - UNI30762 - AAATGGGGACAGAGTGGAAACGTGGACTAGGAGGAGGCTCAAAGCAGCTGGAGGCAGCACCGACAGAACTTGCTTCCAG

ACCCACCAGGGACAAGATGGCGCTGTGACGTGGGTGATGTGGGCAGACACAGCTGGAACCGCCTAGCCACCTTTGCTCTTCAAACACCACTGCAG - UN

I5311 - - UNI15411 - - UNI30762 - CAGATCCACAGATGAGCATGGCCGCCACTGCTGCTGTCAGTCCCAGTGACTACCTGCAGCCTGCTG

CTGCTACTACCCAG - UNI15411 - - UNI17944 - - UNI20078 - GACTCCCAGCCATCTCCCTTGGCCCTGCTTGCTGCGACATGTAGCA

AAATTGGCCCCCCAGCTGTTGAAGCTGCAGTGACACCTCCTGCTCCCCCCCAGCCTACCCCAAGGAAACTGGTCCCTATCAAACCCGCTCCTCTCCCTCT

CAGTCCCTGCAAGAATAGCTTTAGCATCTTATCATCTAAAGGAAATATACTTCAGATTCAGGGCTCCCAGCTGAGTACCTCCTACCCTGGAGGGCAGTTT

GTGTTTGCAATCCAGAACCCCACCCTGATCAACAAAGGGAGCCGATCAAATGCAAGTATCCAGTACCAAGTCCCTCAGATCCAAGGGAACAGTTCCCAGA

CCATCCAGGTGCAGCCCAGTCTCACCAACCAGATCCAGGTCATCCCAGGCACCAACCAAGCCATCACCACCCCGTCAACATCTGGTCATAAGCCTGTCCC

CATCAAGCCAGCTCCTGTCCAGAAGTCAAGTACGACTACCACCCCTGTGCAGAGCGGGGCCAACGTGGTGAAGCTGACAGGCGGGGGTAGCAACATGACG

CTCACCCTGCCGCTCAACAACCTGGTGAACACCAGCGATATTGGGGGCCCTGCTCAGCTCCTCACTGAGAGCCCCCCCACCCCACTGTCTAAGACTAACA

AGAAAGCTAGGAAGAAGAGCCTCCCTGTGTCACAGCCATCCGTAGCTGTGGCTGAGCAGGTGGAGACGGTGCTGATAGAGACCACGGCAGACAACATCAT

CCAGGCAGGAAACAACCTGCTGATCGTCCAGAGCCCTGGCGGGGGCCAGCCAGCTGTGGTCCAGCAAGTCCAGGTGGTGCCACCCAAGGCTGAGCAGCAG

CAGGTGGTCCAGATCCCCCAGCAGGCACTGCGGGTGGTGCAAGCTGCCTCTGCCACCCTCCCCACCGTCCCCCAGAAGCCCTCTCAGAACTTTCAGATCC

AGACAACTGAACCAACACCAACCCAG GTTTATATCCGTACACCTTCTGGTGAGGTACAGACAGTCCTTGTCCAGGACAGCCCCCCAGCAACAGCTGCAA

CCACATCAACCGTCACCTGTAACAGCCCTGCACTCCGAGCTCCCCATCTGAGTGGCACCAGCAAAAAACATTCAGCTGCCATTCTCCGAAAAGAGCGGCC

CCTGCCAAAGATTGCACCTGCTGGGAGCATCATCAGCCTGAACGCCGCACAGCTGGCAGCAGCTGCTCAGGCCATGCAGACCATCAACATCAATGGTGTC

CAAGTCCAGGGTGTGCCTGTCACCATCACCAACACTGGCG GGCAGCAGCAGCTGACCGTGCAGAACGTTTCTGGAAACAACCTGACTATCAGTGGGCTG

AGCCCCACCCAGATCCAGCTGCAGATGGAGCAGGCTCTAGCCGGAGAGGCCCAGCCTGGGGAGAAACGGCGGCGCATGGCCTGCACGTGTCCCAACTGCA

AGGATGGGGAGAAGAG - UNI22063 - GTCTGGGGAGCAGGGCAAGAAGAAGCACGTGTGCCACATCCCGGACTGCGGGAAGACTTTCCGGAAGACA

TCCTTGCTCCGGGCCCACGTCCGCCTGCACACTGGCGAGCGGCCCTTTGTCTGCAACTGGTTCTTCTGTGGAAAGAGATTCACTCGGAGCGATGAACTCC

AGCGACATGCTCGAACCCACACAG - UNI6798 - GGGACAAGCGCTTTGAGTGTGCCCAATGTCAGAAGCGCTTCATGAGGAGTGACCACCTCACCA

AGCATTACAAGACCCACCTAGGCACGAAGGGCTTGTAAGGCCAACTGAGGCAGGAGGCCCTGAAGATGGAACACCTCCCATCTGATTGGCCCTGGGTCCA

TGATGGACAGGTGCCCACGACTGCCCTGGGCAGCCCTCACCCCACTCCTGTTCTGTGGCTGTGTCCCTGCAGAGAGGGACTCTGTTCCTGTGTTCTCCTC

CTTCCAAAGGCTCTGCCCCTCTCACCGTGAGCTCCTGGCCTGCCCAGGCCATGGACACTGGCCATGCCCAATGAGACGTTCTAACCCAG
Translation
 - UNI30762 -  - UNI5311 - - UNI15411 - - UNI30762 - MSMAATAAVSPSDYLQPAAATTQ - UNI15411 - - UNI17944

 - - UNI20078 - DSQPSPLALLAATCSKIGPPAVEAAVTPPAPPQPTPRKLVPIKPAPLPLSPCKNSFSILSSKGNILQIQGSQLSTSYPGGQFVF

AIQNPTLINKGSRSNASIQYQVPQIQGNSSQTIQVQPSLTNQIQVIPGTNQAITTPSTSGHKPVPIKPAPVQKSSTTTTPVQSGANVVKLTGGGSNMTLT

LPLNNLVNTSDIGGPAQLLTESPPTPLSKTNKKARKKSLPVSQPSVAVAEQVETVLIETTADNIIQAGNNLLIVQSPGGGQPAVVQQVQVVPPKAEQQQV

VQIPQQALRVVQAASATLPTVPQKPSQNFQIQTTEPTPTQ VYIRTPSGEVQTVLVQDSPPATAATTSTVTCNSPALRAPHLSGTSKKHSAAILRKERPL

PKIAPAGSIISLNAAQLAAAAQAMQTININGVQVQGVPVTITNTGG GQQQLTVQNVSGNNLTISGLSPTQIQLQMEQALAGEAQPGEKRRRMACTCPNC

KDGEKR - UNI22063 - RSGEQGKKKHVCHIPDCGKTFRKTSLLRAHVRLHTGERPFVCNWFFCGKRFTRSDELQRHARTHTG - UNI6798 - G

DKRFECAQCQKRFMRSDHLTKHYKTHLGTKGL

For any suggestions or comments, please send an email to unitrap@crg.es