Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000018697 (Aatf)
Chromosomal location
Chr 11: 84236358 - 84327003 (-)
Description
apoptosis antagonizing transcription factor Gene [Source:MGI (curated);Acc:Aatf-001]
RefSeq_dna
NM_019816 
RefSeq_peptide
NP_062790.1 
MGI
MGI:1929608 
Uniprot/SWISSPROT
Q9JKX4 
Uniprot/SPTREMBL
Q3URN5 
Human Ortholog
ENSG00000108270 (AATF)
Omim not available
UniTrap UNI138
Vector Insertion
Chr 11: 84286669 - 84323160
Public Clones GC0098 (tigem) GC0591 (tigem) RRD065 (baygenomics) XE509 (baygenomics)
YTA370 (baygenomics) W027C04 (ggtc) PST1370-1 (escells) PST5615-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28254
Vector Insertion
Chr 11: 84236522 - 84256067
Public Clones not available
Private Clones OST35912 (lexicon) OST23164 (lexicon) OST20651 (lexicon) OST18851 (lexicon)
OST2777 (lexicon)
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000018841
Sequence
TCCGCCTTGAGTTGCCAAGTAGAGTCTGGGCCGTAGCGCCACTGCTGCGAGTGTCGGGCCGGGGGGCTCGGGCTGCAGTGCAGGTTCACGAGCGCAGCGC

CGGCAGTGACCTGGTGACCATGGCGGCGCCGCAGCCCTTGGCTCTGCAGCTGGAACAGTTGCTGAATCCGAGACCGCGTGAGGCGGATCCTGAGGCCGAC

CCGGAGGAGG CCACTAGAGCCAGAGTGATTGACAGGTTTGATGAAGGGGAAGAGGAGAAAGATGATCTGGCAGTGAGTAGCATTAGAAAGTTGGCACCA

GTCTCCCTCTTGGACACCGACAAAAGGTATTCTGGCAAGACCACTTCTAGGAAAGCTTGGAAAGAAGACCATTGGGAGCAGGCTCTGCCAAGTTCATCTG

 ATAACGAAGCATCTGATGAGGGAGGATCTGAAGATGGGGATTCAGAGGGCCTGGGCCTGGAGGAGATCTCAGAAGATGTTGACGAAGACTTAGAAG AC

AACAAAATATCTGATGAGGGAGGATCTGAAGATGGGGATTCAGAGGGCCTGGGCCTGGAAGAGTTCTCAGAAGATGTTGAGGAGGACTTAGAAGGTGAGG

ATGAGGAAGACAGAGAAGAAGACAGGAACAGTGAAGATGATGGTGTGGTGGCAGCCTTCTCCAGTGTCAAAGTTTCTGAGGAAGTGGAAAAAGGAAGAGC

TGTGAAGAATCAGATAG CATTGTGGGACCAGCTCTTGGAAGGAAGGATCAAGCTACAAAAAGCTCTCTTGACTACCAATCAGTTGCCTCAACCAGATGT

TTTCCCTGTCTTCAAGGACAAAGGTGGCCCAGAATTTGCCAGTGCTCTGAAAAATA - UNI138 - GTCACAAAGCACTTAAAGCCTTGTTAAGGTCA

TTGGTGGATCTTCAGGAAGAGTTGCTTTTCCAGTACCCAGACACGAGACATATAGTAAATGGGGCGAAACCCAATACAGAGAG TGAGGAGATTTCCAGT

GAAGATGATGAGCTAGTGGGAGAGAAGAAGAAACAACGAAAGGCCCCACCCAAGAGGAAGCTAGAGATGGAGGACTATCCCAGCTTCATGGCAAAGCGCT

TTGCTGACTTCACCATCTATAGGAATCACACACTACAGAAATGGCATGATAAAACCAAGCTTGCTTCTGGAAAACTGGGCAAG GGTTTTGGTGCCTTCG

AACGCTCGATCTTGACTCAGATCGATCATATCATGATGGACAAAGAAAGATTGCTTCGGAGGACACAGACCAAGCGCTCTGCCTACCGAGTTCTTGGCAA

ACCGGAGCCAGTCCCTGAGCCTGTTGCAGAGACCTTGCCAGGAGAACCA GAGACGCTTCCTCAGGGCCCTGCCAATGCCCACCTGAGGGACTTGGATGA

GGAGATATTTGATGATGATGACTTTTACCACCAG CTCCTTCGAGAACTCATAGAGCGGAAAACCAGCTCTTTGGATCCAAATGATCAGGTGGCCATGGG

AAG GCAGTGGCTTGCAATCCAGAAACTACGAAGCAAAATCCGCAAGAAGGTAGATAGAAAAGCCAGCAAAGGAAGGAAACTTCG GTTCCATGTCCTTA

GCAAGCTCCTGAGTTTCATGGCACCTATTGACCACACCGCAATGAGTGATGATGCCAG - UNI28254 - GACGGAGTTGTTTCGATCTCTTTTCGGC

CAGCTCAACCCTCCTGATGCAGACCGTGGGAAGTGACAGTAGCATCCTCTCAGGCCCGACCTCAGCACAGGACCCACCTGCTGCCTCCAATAAAATGATC

AAAAACTACAATAAACCTTTTTTTTTTTAATCTGTT
Translation
MAAPQPLALQLEQLLNPRPREADPEADPEEA ATRARVIDRFDEGEEEKDDLAVSSIRKLAPVSLLDTDKRYSGKTTSRKAWKEDHWEQALPSSSD DNE

ASDEGGSEDGDSEGLGLEEISEDVDEDLED DNKISDEGGSEDGDSEGLGLEEFSEDVEEDLEGEDEEDREEDRNSEDDGVVAAFSSVKVSEEVEKGRAV

KNQIA ALWDQLLEGRIKLQKALLTTNQLPQPDVFPVFKDKGGPEFASALKNS - UNI138 - SHKALKALLRSLVDLQEELLFQYPDTRHIVNGAKP

NTES SEEISSEDDELVGEKKKQRKAPPKRKLEMEDYPSFMAKRFADFTIYRNHTLQKWHDKTKLASGKLGK GFGAFERSILTQIDHIMMDKERLLRRT

QTKRSAYRVLGKPEPVPEPVAETLPGEP ETLPQGPANAHLRDLDEEIFDDDDFYHQ LLRELIERKTSSLDPNDQVAMGR RQWLAIQKLRSKIRKKVD

RKASKGRKLR RFHVLSKLLSFMAPIDHTAMSDDAR - UNI28254 - RTELFRSLFGQLNPPDADRGK
Transcript ENSMUST00000108085
Sequence
TCCGCCTTGAGTTGCCAAGTAGAGTCTGGGCCGTAGCGCCACTGCTGCGAGTGTCGGGCCGGGGGGCTCGGGCTGCAGTGCAGGTTCACGAGCGCAGCGC

CGGCAGTGACCTGGTGACCATGGCGGCGCCGCAGCCCTTGGCTCTGCAGCTGGAACAGTTGCTGAATCCGAGACCGCGTGAGGCGGATCCTGAGGCCGAC

CCGGAGGAGG CCACTAGAGCCAGAGTGATTGACAGGTTTGATGAAGGGGAAGAGGAGAAAGATGATCTGGCAGTGAGTAGCATTAGAAAGTTGGCACCA

GTCTCCCTCTTGGACACCGACAAAAGGTATTCTGGCAAGACCACTTCTAGGAAAGCTTGGAAAGAAGACC CATTGTGGGACCAGCTCTTGGAAGGAAGG

ATCAAGCTACAAAAAGCTCTCTTGACTACCAATCAGTTGCCTCAACCAGATGTTTTCCCTGTCTTCAAGGACAAAGGTGGCCCAGAATTTGCCAGTGCTC

TGAAAAATA - UNI138 - GTCACAAAGCACTTAAAGCCTTGTTAAGGTCATTGGTGGATCTTCAGGAAGAGTTGCTTTTCCAGTACCCAGACACGAG

ACATATAGTAAATGGGGCGAAACCCAATACAGAGAG TGAGGAGATTTCCAGTGAAGATGATGAGCTAGTGGGAGAGAAGAAGAAACAACGAAAGGCCCC

ACCCAAGAGGAAGCTAGAGATGGAGGACTATCCCAGCTTCATGGCAAAGCGCTTTGCTGACTTCACCATCTATAGGAATCACACACTACAGAAATGGCAT

GATAAAACCAAGCTTGCTTCTGGAAAACTGGGCAAG GGTTTTGGTGCCTTCGAACGCTCGATCTTGACTCAGATCGATCATATCATGATGGACAAAGAA

AGATTGCTTCGGAGGACACAGACCAAGCGCTCTGCCTACCGAGTTCTTGGCAAACCGGAGCCAGTCCCTGAGCCTGTTGCAGAGACCTTGCCAGGAGAAC

CA GAGACGCTTCCTCAGGGCCCTGCCAATGCCCACCTGAGGGACTTGGATGAGGAGATATTTGATGATGATGACTTTTACCACCAG CTCCTTCGAGAA

CTCATAGAGCGGAAAACCAGCTCTTTGGATCCAAATGATCAGGTGGCCATGGGAAG GCAGTGGCTTGCAATCCAGAAACTACGAAGCAAAATCCGCAAG

AAGGTAGATAGAAAAGCCAGCAAAGGAAGGAAACTTCG GTTCCATGTCCTTAGCAAGCTCCTGAGTTTCATGGCACCTATTGACCACACCGCAATGAGT

GATGATGCCAG - UNI28254 - GACGGAGTTGTTTCGATCTCTTTTCGGCCAGCTCAACCCTCCTGATGCAGACCGTGGGAAGTGACAGTAGCATCC

TCTCAGGCCCGACCTCAGCACAGGACCCACCTGCTGCCTCCAATAAAATGATCAAAAACTACAATAAACCTTTTTTTTTTTAATCTGTT
Translation
MAAPQPLALQLEQLLNPRPREADPEADPEEA ATRARVIDRFDEGEEEKDDLAVSSIRKLAPVSLLDTDKRYSGKTTSRKAWKEDP PLWDQLLEGRIKL

QKALLTTNQLPQPDVFPVFKDKGGPEFASALKNS - UNI138 - SHKALKALLRSLVDLQEELLFQYPDTRHIVNGAKPNTES SEEISSEDDELVGE

KKKQRKAPPKRKLEMEDYPSFMAKRFADFTIYRNHTLQKWHDKTKLASGKLGK GFGAFERSILTQIDHIMMDKERLLRRTQTKRSAYRVLGKPEPVPEP

VAETLPGEP ETLPQGPANAHLRDLDEEIFDDDDFYHQ LLRELIERKTSSLDPNDQVAMGR RQWLAIQKLRSKIRKKVDRKASKGRKLR RFHVLSKL

LSFMAPIDHTAMSDDAR - UNI28254 - RTELFRSLFGQLNPPDADRGK

For any suggestions or comments, please send an email to unitrap@crg.es