Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000018752 (Tnfsf12)
Chromosomal location
Chr 11: 69496079 - 69509600 (-)
Description
tumor necrosis factor (ligand) superfamily, member 12 Gene [Source:MGI (curated);Acc:Tnfsf12-002]
RefSeq_dna
NM_001034097 NM_011614 
RefSeq_peptide
NP_001029269.1 NP_001029270.1 NP_076006.2 NP_035744.1 
UniGene
Mm.8983 
MGI
MGI:1196259 MGI:1916833 
Uniprot/SWISSPROT
Q9D777 O54907 
Uniprot/SPTREMBL
Q8BXS2 Q5F2A1 B0QZJ0 Q5F2A3 Q5F2A4 Q3TBX2 Q5F2A0 
Human Ortholog
ENSG00000161955 (TNFSF13)
Omim not available
UniTrap UNI17242
Vector Insertion
Chr 11: 69508895 - 69508944
Public Clones not available
Private Clones OST446905 (lexicon) OST418407 (lexicon) OST290052 (lexicon) OST205466 (lexicon)
OST194813 (lexicon) OST149561 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22491
Vector Insertion
Chr 11: 69508328 - 69508895
Public Clones IST14176C2 (tigm) IST15065B12 (tigm)
Private Clones OST295426 (lexicon) OST267805 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8554
Vector Insertion
Chr 11: 69507177 - 69508251
Public Clones RRO320 (baygenomics) IST10616G7 (tigm) IST13953F2 (tigm) IST12342C10 (tigm)
IST13261B10 (tigm) IST14990F3 (tigm) IST14207D3 (tigm) IST13175A8 (tigm)
IST13519A2 (tigm)
Private Clones OST259234 (lexicon) OST242925 (lexicon) OST231080 (lexicon) OST230701 (lexicon)
OST210881 (lexicon) OST189654 (lexicon) OST99904 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13018
Vector Insertion
Chr 11: 69507044 - 69507122
Public Clones CMHD-GT_339B3-3 (cmhd)
Private Clones OST193905 (lexicon) OST169176 (lexicon) OST65281 (lexicon)
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21090
Vector Insertion
Chr 11: 69500879 - 69507007
Public Clones IST13913G10 (tigm) IST14168H2 (tigm) IST10209E12 (tigm) IST12714D3 (tigm)
IST14530H7 (tigm) IST14672B10 (tigm) IST14408E1 (tigm) IST10712B12 (tigm)
IST13885C11 (tigm) IST10991E3 (tigm) IST11210E3 (tigm) IST15103D2 (tigm)
IST12781A1 (tigm) IST13988C10 (tigm) IST12087B12 (tigm) IST14391F2 (tigm)
IST10091E8 (tigm) IST11078C1 (tigm) IST14635F4 (tigm) IST11487H12 (tigm)
IST14209C11 (tigm) IST13406B11 (tigm) IST13919B5 (tigm) IST11486B3 (tigm)
IST10007C12 (tigm)
Private Clones OST341515 (lexicon) OST308362 (lexicon) OST251087 (lexicon) OST207227 (lexicon)
OST188290 (lexicon) OST188072 (lexicon) OST168603 (lexicon) OST138358 (lexicon)
OST36722 (lexicon) OST31172 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19360
Vector Insertion
Chr 11: 69500594 - 69500753
Public Clones IST13224G5 (tigm) IST12649B2 (tigm) IST14504E11 (tigm) IST10567A7 (tigm)
IST14504F7 (tigm)
Private Clones OST393421 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30460
Vector Insertion
Chr 11: 69500341 - 69500594
Public Clones CMHD-GT_328C10-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30001
Vector Insertion
Chr 11: 69498530 - 69500594
Public Clones D159H07 (ggtc) PST22709-NR (escells) IST10960B7 (tigm) IST14834D10 (tigm)
IST15071F6 (tigm) IST12649B2 (tigm) IST11105B3 (tigm) IST14719E5 (tigm)
IST15024A1 (tigm) IST13188A4 (tigm) IST10391B4 (tigm) IST13635D9 (tigm)
IST13930B6 (tigm) IST14311G10 (tigm) IST13329G8 (tigm) IST11371B11 (tigm)
IST12008D2 (tigm) IST15071F7 (tigm) IST14326F11 (tigm) IST14439A5 (tigm)
IST11020E8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14358
Vector Insertion
Chr 11: 69498161 - 69498633
Public Clones FHCRC-GT-S17-1H1 (fhcrc) IST14370B8 (tigm) IST14788G2 (tigm)
Private Clones OST48531 (lexicon) OST35738 (lexicon)
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12927
Vector Insertion
Chr 11: 69498035 - 69498161
Public Clones CMHD-GT_352F11-3 (cmhd) IST10682E11 (tigm) IST11892E11 (tigm) IST13436B9 (tigm)
Private Clones OST48628 (lexicon)
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31287
Vector Insertion
Chr 11: 69497719 - 69498035
Public Clones IST14936D2 (tigm) IST13436B9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16303
Vector Insertion
Chr 11: 69497495 - 69497719
Public Clones (cmhd) IST11070F9 (tigm)
Private Clones OST463527 (lexicon)
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30878
Vector Insertion
Chr 11: 69496078 - 69497495
Public Clones (cmhd) IST14542G8 (tigm) IST14691A1 (tigm) IST12640D7 (tigm) IST11087C8 (tigm)
IST12044B7 (tigm) IST15103G3 (tigm) IST13203B9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108650
Sequence
TGCGGTCGCCTGCCTGCACGCGCCCGGGCGCAGGACGTCTCTTACTTCTTGCACAGCACTCCGGGGAGGTTGGAGTTTAATCACACAAACAGTGTCCGGC

TTCCTGTCCTCATCCGCCCCCCCTCCGGCCCGCTTCCCTGGTCCCTCCCTCTCCCCTGGCCCGATCCGCCCACCAGCTCCCCCTCCCCATCCCTCGGGTC

CCGGGATGGGGGGGCGGTGAGGCAGGCACAGCCCCCCGCCCCCATGGCCGCCCGTCGGAGCCAGAGGCGGAGGGGGCGCCGGGGGGAGCCGGGCACCGCC

CTGCTGGCCCCGCTGGTGCTGAGCCTGGGCCTGGCGCTGGCCTGCCTTGGCCTCCTGCTGGTCGTGGTCAGCCTGGGGAGCTGGGCAACGCTGTCTGCCC

AG CAGGAGCCTTCTCAGGAGGAGCTGACAGCAGAGGACCGCCGGGAGCCCCCT - UNI17242 - - UNI22491 - GAACTGAATCCCCAGACAG

AGGAAAGCCAGGATGTGGTACCTTTCTTGGAACAACTAGTCCGGCCTCGAAGAAGTG - UNI8554 - CTCCTAAAGGCCGGAAGGCGCGGCCTCGCC

GAGCTATTGCAGCCCATTATGAGG - UNI13018 - TTCATCCTCGGCCAGGACAGGATGGAGCACAAGCAG - UNI21090 - GTGTGGATGGGA

CAGTGAGTGGCTGGGAAGAGACCAAAATCAACAGCTCCAGCCCTCTGCGCTACGACCGCCAGATTGGGGAATTTACAGTCATCAGGGCTGGGCTCTACTA

CCTGTACTGTCAG - UNI19360 - - UNI30001 - - UNI30460 - GTGCACTTTGATGAGGGAAAGGCTGTCTACCTGAAGCTGGACTTGCT

GGTGAACGGTGTGCTGGCCCTGCGCTGCCTGGAAGAATTCTCAGCCACAGCAGCAAGCTCTCCTGGGCCCCAGCTCCGTTTGTGCCAG - UNI14358 

- - UNI30001 - - UNI30460 - ACAGAGCTGCAAAGCCTAAGGCGGGAGGTGAGCCGGCTGCAGCGGAGTGGAGGGCCTTCCCAGAAGCAGGGA

GAGCGCCCATGGCAGAGCCTCTGGGAGCAG - UNI14358 - - UNI30001 - AGTCCTGATGTCCTGGAAGCCTGGAAGGATGGGGCGAAATCTC

GGAGAAGGAGAGCAGTACTCACCCAGAAGCACAAGA - UNI12927 - - UNI14358 - - UNI31287 - AGAAGCACTCAGTCCTGCATCTTG

TTCCAGTTAACATTACCTCCAAGG - UNI31287 - CAGACTCTGACGTGACAGAGGTGATGTGGCAACCAGTACTTAGGCGTGGGAGAGGCCTGGAG

GCCCAGGGAGACATTGTACGAGTCTGGGACACTGGAATTTATCTGCTCTATAGTCAG - UNI16303 - - UNI30878 - - UNI31287 - GTC

CTGTTTCATGATGTGACTTTCACAATGGGTCAGGTGGTATCTCGGGAAGGACAAGGGAGAAGAGAAACTCTATTCCGATGTATCAGAAGTATGCCTTCTG

ATCCTGACCGTGCCTACAATAGCTGCTACAGTGCAG - UNI30878 - GTGTCTTTCATTTACATCAAGGGGATATTATCACTGTCAAAATTCCACGG

GCAAACGCAAAACTTAGCCTTTCTCCGCATGGAACATTCCTGGGGTTTGTGAAACTATGATTGTTATAAAGGGGGTGGGGATTTCCCATTCCAAAAACTG

GCTAGACAAAGGACAAGGAACGGTCAAGAACAGCTCTCCATGGCTTTGCCTTGACTGTTGTTCCTCCCTTTGCCTTTCCCGCTCCCACTATCTGGGCTTT

GACTCCATGGATATTAAAAAAGTAGAATATTTTGTGTTTATCTCCCACACAGCCCCAAATTCTTTTGTTGTGTGTGCGAAGGGGGTTTTGCGCACTGTGC

CAAGCCTTGTCCACTGGAATGCATCCAGAACAGCAGCACCATCTAGCGGCAGGTTGAGGAAAGACTATGGTCTCTGCTAGGGAAAACCTTATCCAACTCT

TCAAGTACCCTCTGCTTCAATTAACAAGAAGCCCGGCTTTCAGTATTTCACCTATTGCGTCCAAATTCTTGTTACTATCTAGAAAAAGATATATGTTAGG

TGCCTCGATATGCATGCCATTCATCCTCCCCATTCTCCTATACACTTCCGAGCTGGGCACTGAGCTTTACGCCTTAAATCACAGTACTCGGGAGGCAGAT

CTCGATGAGTTCGAGGCCAACTTGGTCTAAATAGTGAGTTCCAGGCCACCCAGGGGTTACAATGGTGAGACCCTGTCTCAAACAAACTAACAAACAAATA

AACGAAAGGCTCTCCACG
Translation
MAARRSQRRRGRRGEPGTALLAPLVLSLGLALACLGLLLVVVSLGSWATLSAQ QEPSQEELTAEDRREPP - UNI17242 - - UNI22491 - EL

NPQTEESQDVVPFLEQLVRPRRSA - UNI8554 - APKGRKARPRRAIAAHYEV - UNI13018 - VHPRPGQDGAQAG - UNI21090 - GVD

GTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQ - UNI19360 - - UNI30001 - - UNI30460 - VHFDEGKAVYLKLDLLVNGVL

ALRCLEEFSATAASSPGPQLRLCQ - UNI14358 - - UNI30001 - - UNI30460 - TELQSLRREVSRLQRSGGPSQKQGERPWQSLWEQ -

 UNI14358 - - UNI30001 - SPDVLEAWKDGAKSRRRRAVLTQKHKK - UNI12927 - - UNI14358 - - UNI31287 - KKHSVLHL

VPVNITSKA - UNI31287 - ADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQ - UNI16303 - - UNI30878 - - UNI31287

 - VLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAG - UNI30878 - GVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL

Transcript ENSMUST00000094070
Sequence
GGGGCCAGGGCCCGCGTCCCATCCCTGGCACACTGGCCTGGGTGGGTGCCTGTCCACTTCTGCTTTCACTGGCCCTCAGAGTTCTTGGTCTGGAGTGCCA

CTGCGGTCGCCTGCCTGCACGCGCCCGGGCGCAGGACGTCTCTTACTTCTTGCACAGCACTCCGGGGAGGTTGGAGTTTAATCACACAAACAGTGTCCGG

CTTCCTGTCCTCATCCGCCCCCCCTCCGGCCCGCTTCCCTGGTCCCTCCCTCTCCCCTGGCCCGATCCGCCCACCAGCTCCCCCTCCCCATCCCTCGGGT

CCCGGGATGGGGGGGCGGTGAGGCAGGCACAGCCCCCCGCCCCCATGGCCGCCCGTCGGAGCCAGAGGCGGAGGGGGCGCCGGGGGGAGCCGGGCACCGC

CCTGCTGGCCCCGCTGGTGCTGAGCCTGGGCCTGGCGCTGGCCTGCCTTGGCCTCCTGCTGGTCGTGGTCAGCCTGGGGAGCTGGGCAACGCTGTCTGCC

CAG - UNI17242 - GAGCCTTCTCAGGAGGAGCTGACAGCAGAGGACCGCCGGGAGCCCCCT - UNI17242 - - UNI22491 - GAACTGAA

TCCCCAGACAGAGGAAAGCCAGGATGTGGTACCTTTCTTGGAACAACTAGTCCGGCCTCGAAGAAGTG - UNI8554 - CTCCTAAAGGCCGGAAGGC

GCGGCCTCGCCGAGCTATTGCAGCCCATTATGAGG - UNI13018 - TTCATCCTCGGCCAGGACAGGATGGAGCACAAGCAG - UNI21090 - G

TGTGGATGGGACAGTGAGTGGCTGGGAAGAGACCAAAATCAACAGCTCCAGCCCTCTGCGCTACGACCGCCAGATTGGGGAATTTACAGTCATCAGGGCT

GGGCTCTACTACCTGTACTGTCAG - UNI19360 - - UNI30001 - - UNI30460 - GTGCACTTTGATGAGGGAAAGGCTGTCTACCTGAAG

CTGGACTTGCTGGTGAACGGTGTGCTGGCCCTGCGCTGCCTGGAAGAATTCTCAGCCACAGCAGCAAGCTCTCCTGGGCCCCAGCTCCGTTTGTGCCAG 

- UNI14358 - - UNI30001 - - UNI30460 - ACAGAGCTGCAAAGCCTAAGGCGGGAGGTGAGCCGGCTGCAGCGGAGTGGAGGGCCTTCCC

AGAAGCAGGGAGAGCGCCCATGGCAGAGCCTCTGGGAGCAG - UNI14358 - - UNI30001 - AGTCCTGATGTCCTGGAAGCCTGGAAGGATGG

GGCGAAATCTCGGAGAAGGAGAGCAGTACTCACCCAGAAGCACAAGA - UNI12927 - - UNI14358 - - UNI31287 - AGAAGCACTCAGT

CCTGCATCTTGTTCCAGTTAACATTACCTCCAAGG - UNI31287 - ACTCTGACGTGACAGAGGTGATGTGGCAACCAGTACTTAGGCGTGGGAGAG

GCCTGGAGGCCCAGGGAGACATTGTACGAGTCTGGGACACTGGAATTTATCTGCTCTATAGTCAG - UNI16303 - - UNI30878 - - UNI312

87 - GTCCTGTTTCATGATGTGACTTTCACAATGGGTCAGGTGGTATCTCGGGAAGGACAAGGGAGAAGAGAAACTCTATTCCGATGTATCAGAAGTAT

GCCTTCTGATCCTGACCGTGCCTACAATAGCTGCTACAGTGCAG - UNI30878 - GTGTCTTTCATTTACATCAAGGGGATATTATCACTGTCAAAA

TTCCACGGGCAAACGCAAAACTTAGCCTTTCTCCGCATGGAACATTCCTGGGGTTTGTGAAACTATGATTGTTATAAAGGGGGTGGGGATTTCCCATTCC

AAAAACTGGCTAGACAAAGGACAAGGAACGGTCAAGAACAGCTCTCCATGGCTTTGCCTTGACTGTTGTTCCTCCCTTTGCCTTTCCCGCTCCCACTATC

TGGGCTTTGACTCCATGGATATTAAAAAAGTAGAATATTTTGTGTTTATCTCCCACACAGCCCCAAATTCTTTTGTTGTGTGTGCGAAGGGGGTTTTGCG

CACTGTGCCAAGCCTTGTCCACTGGAATGCATCCAGAACAGCAGCACCATCTAGCGGCAGGTTGAGGAAAGACTATGGTCTCTGCTAGGGAAAACCTTAT

CCAACTCTTCAAGTACCCTCTGCTTCAATTAACAAGAAGCCCGGCTTTCAGTATTTCACCTATTGCGTCCAAATTCTTGTTACTATCTAGAAAAAGATAT

ATGTTAGGTGCCTCGATATGCATGCCATTCATCCTCCCCATTCTCCTATACACTTCCGAGCTGGGCACTGAGCTTTACGCCTTAAATCACAGTACTCGGG

AGGCAGATCTCGATGAGTTCGAGGCCAACTTGGTCTAAATAGTGAGTTCCAGGCCACCCAGGGGTTACAATGGTGAGACCCTGTCTCAAACAAACTAACA

AACAAATAAACGAAAGGCTCTCCACG
Translation
MAARRSQRRRGRRGEPGTALLAPLVLSLGLALACLGLLLVVVSLGSWATLSAQ - UNI17242 - EPSQEELTAEDRREPP - UNI17242 - - U

NI22491 - ELNPQTEESQDVVPFLEQLVRPRRSA - UNI8554 - APKGRKARPRRAIAAHYEV - UNI13018 - VHPRPGQDGAQAG - UN

I21090 - GVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQ - UNI19360 - - UNI30001 - - UNI30460 - VHFDEGKAV

YLKLDLLVNGVLALRCLEEFSATAASSPGPQLRLCQ - UNI14358 - - UNI30001 - - UNI30460 - TELQSLRREVSRLQRSGGPSQKQG

ERPWQSLWEQ - UNI14358 - - UNI30001 - SPDVLEAWKDGAKSRRRRAVLTQKHKK - UNI12927 - - UNI14358 - - UNI3128

7 - KKHSVLHLVPVNITSKD - UNI31287 - DSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQ - UNI16303 - - UNI30878 -

 - UNI31287 - VLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAG - UNI30878 - GVFHLHQGDIITVKIPRANAKLSLS

PHGTFLGFVKL
Transcript ENSMUST00000108649
Sequence
ATCCCTCGGGTCCCGGGATGGGGGGGCGGTGAGGCAGGCACAGCCCCCCGCCCCCATGGCCGCCCGTCGGAGCCAGAGGCGGAGGGGGCGCCGGGGGGAG

CCGGGCACCGCCCTGCTGGCCCCGCTGGTGCTGAGCCTGGGCCTGGCGCTGGCCTGCCTTGGCCTCCTGCTGGTCGTGGTCAGCCTGGGGAGCTGGGCAA

CGCTGTCTGCCCAG - UNI17242 - GAGCCTTCTCAGGAGGAGCTGACAGCAGAGGACCGCCGGGAGCCCCCT - UNI17242 - - UNI22491

 - GAACTGAATCCCCAGACAGAGGAAAGCCAGGATGTGGTACCTTTCTTGGAACAACTAGTCCGGCCTCGAAGAAGTG - UNI8554 - CTCCTAAA

GGCCGGAAGGCGCGGCCTCGCCGAGCTATTGCAGCCCATTATGAGG - UNI13018 - TTCATCCTCGGCCAGGACAGGATGGAGCACAAGCAG - U

NI21090 - GTGTGGATGGGACAGTGAGTGGCTGGGAAGAGACCAAAATCAACAGCTCCAGCCCTCTGCGCTACGACCGCCAGATTGGGGAATTTACAG

TCATCAGGGCTGGGCTCTACTACCTGTACTGTCAG - UNI14358 - - UNI19360 - - UNI30001 - - UNI30460 - AGTCCTGATGTC

CTGGAAGCCTGGAAGGATGGGGCGAAATCTCGGAGAAGGAGAGCAGTACTCACCCAGAAGCACAAGA - UNI12927 - - UNI14358 - - UNI3

1287 - AGAAGCACTCAGTCCTGCATCTTGTTCCAGTTAACATTACCTCCAAGG - UNI31287 - ACTCTGACGTGACAGAGGTGATGTGGCAACC

AGTACTTAGGCGTGGGAGAGGCCTGGAGGCCCAGGGAGACATTGTACGAGTCTGGGACACTGGAATTTATCTGCTCTATAGTCAG - UNI16303 - -

 UNI30878 - - UNI31287 - GTCCTGTTTCATGATGTGACTTTCACAATGGGTCAGGTGGTATCTCGGGAAGGACAAGGGAGAAGAGAAACTCTA

TTCCGATGTATCAGAAGTATGCCTTCTGATCCTGACCGTGCCTACAATAGCTGCTACAGTGCAG - UNI30878 - GTGTCTTTCATTTACATCAAGG

GGATATTATCACTGTCAAAATTCCACGGGCAAACGCAAAACTTAGCCTTTCTCCGCATGGAACATTCCTGGGGTTTGTGAAACTATGATTGT
Translation
MAARRSQRRRGRRGEPGTALLAPLVLSLGLALACLGLLLVVVSLGSWATLSAQ - UNI17242 - EPSQEELTAEDRREPP - UNI17242 - - U

NI22491 - ELNPQTEESQDVVPFLEQLVRPRRSA - UNI8554 - APKGRKARPRRAIAAHYEV - UNI13018 - VHPRPGQDGAQAG - UN

I21090 - GVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQ - UNI14358 - - UNI19360 - - UNI30001 - - UNI3046

0 - SPDVLEAWKDGAKSRRRRAVLTQKHKK - UNI12927 - - UNI14358 - - UNI31287 - KKHSVLHLVPVNITSKD - UNI31287 

- DSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQ - UNI16303 - - UNI30878 - - UNI31287 - VLFHDVTFTMGQVVSREGQ

GRRETLFRCIRSMPSDPDRAYNSCYSAG - UNI30878 - GVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
Transcript ENSMUST00000108648
Sequence
ATGCCAGCCTCATCTCCAGGCCACATGGGGGGCTCAGTCAGAGAGCCAGCCCTTTCGGTTGCTCTTTGGTTGAGTTGGGGGGCAGTTCTGGGGGCTGTGA

CTTGTGCTGTCGCACTACTGATCCAACAGACAGAGCTGCAAAGCCTAAGGCGGGAGGTGAGCCGGCTGCAGCGGAGTGGAGGGCCTTCCCAGAAGCAGGG

AGAGCGCCCATGGCAGAGCCTCTGGGAGCAG - UNI14358 - - UNI30001 - AGTCCTGATGTCCTGGAAGCCTGGAAGGATGGGGCGAAATCT

CGGAGAAGGAGAGCAGTACTCACCCAGAAGCACAAGA - UNI12927 - - UNI14358 - - UNI31287 - ACTCTGACGTGACAGAGGTGATG

TGGCAACCAGTACTTAGGCGTGGGAGAGGCCTGGAGGCCCAGGGAGACATTGTACGAGTCTGGGACACTGGAATTTATCTGCTCTATAGTCAG - UNI1

6303 - - UNI30878 - - UNI31287 - GTCCTGTTTCATGATGTGACTTTCACAATGGGTCAGGTGGTATCTCGGGAAGGACAAGGGAGAAGAG

AAACTCTATTCCGATGTATCAGAAGTATGCCTTCTGATCCTGACCGTGCCTACAATAGCTGCTACAGTGCAG - UNI30878 - GTGTCTTTCATTTA

CATCAAGGGGATATTATCACTGTCAAAATTCCACGGGCAAACGCAAAACTTAGCCTTTCTCCGCATGGAACATTCCTGGGGTTTGTGAAACTATGATTGT

TATAAAGGGGGTGGGGATTTCCCATTCCAAAAACTGGCTAGACAAAGGACAAGGAACGGTCAAGAACAGCTCTCCATGGCTTTGCCTTGACTGTTGTTCC

TCCCTTTGCCTTTCCCGCTCCCACTATCTGGGCTTTGACTCCATGGATATTAAAAAAGTAGAATATTTTGTGTTTATCTCCCACACAGCCCCAAATTCTT

TTGTTGTGTGTGCGAAGGGGGTTTTGCGCACTGTGCCAAGCCTTGTCCACTGGAATGCATCCAGAACAGCAGCACCATCTAGCGGCAGGTTGAGGAAAGA

CTATGGTCTCTGCTAGGGAAAACCTTATCCAACTCTTCAAGTACCCTCTGCTTCAATTAACAAGAAGCCCGGCTTTCAGTATTTCACCTATTGCGTCCAA

ATTCTTGTTACTATCTAGAAAAAGATATATGTTAGGTGCCTCGATATGCATGCCATTCATCCTCCCCATTCTCCTATACACTTCCGAGCTGGGCACTGAG

CTTTACGCCTTAAATCACAGTACTCGGGAGGCAGATCTCGATGAGTTCGAGGCCAACTTGGTCTAAATAGTGAGTTCCAGGCCACCCAGGGGTTACAATG

GTGAGACCCTGTCTCAAACAAACTAACAAACAAATAAACGAAAGGCTCTCCACG
Translation
MPASSPGHMGGSVREPALSVALWLSWGAVLGAVTCAVALLIQQTELQSLRREVSRLQRSGGPSQKQGERPWQSLWEQ - UNI14358 - - UNI3000

1 - SPDVLEAWKDGAKSRRRRAVLTQKHKN - UNI12927 - - UNI14358 - - UNI31287 - NSDVTEVMWQPVLRRGRGLEAQGDIVRVW

DTGIYLLYSQ - UNI16303 - - UNI30878 - - UNI31287 - VLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAG - 

UNI30878 - GVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
Transcript ENSMUST00000018896
Sequence
GAAGGCTGGCCGCTCCTTCTGGGTGTCACGGCTGCCCTGTCCTTCCTAGATAATGGCACCAAATTCTCCTGAGGCTAGGGGGGAAGGAGTGTCAGAGTGT

CACTAGCTCGACCCTGGGGACAAGGGGGACTAATAGTACCCTAGCTTGATTTCTTCCTATTCTCAAGTTCCTTTTTATTTCTCCCTTGCGTAACCCGCTC

TTCCCTTCTGTGCCTTTGCCTGTATTCCCACCCTCCCTGCTACCTCTTGGCCACCTCACTTCTGAGACCACAGCTGTTGGCAGGGTCCCTAGCTCATGCC

AGCCTCATCTCCAGGCCACATGGGGGGCTCAGTCAGAGAGCCAGCCCTTTCGGTTGCTCTTTGGTTGAGTTGGGGGGCAGTTCTGGGGGCTGTGACTTGT

GCTGTCGCACTACTGATCCAACAGACAGAGCTGCAAAGCCTAAGGCGGGAGGTGAGCCGGCTGCAGCGGAGTGGAGGGCCTTCCCAGAAGCAGGGAGAGC

GCCCATGGCAGAGCCTCTGGGAGCAG - UNI14358 - - UNI30001 - AGTCCTGATGTCCTGGAAGCCTGGAAGGATGGGGCGAAATCTCGGAG

AAGGAGAGCAGTACTCACCCAGAAGCACAAGA - UNI12927 - - UNI14358 - - UNI31287 - AGAAGCACTCAGTCCTGCATCTTGTTCC

AGTTAACATTACCTCCAAGG - UNI31287 - ACTCTGACGTGACAGAGGTGATGTGGCAACCAGTACTTAGGCGTGGGAGAGGCCTGGAGGCCCAGG

GAGACATTGTACGAGTCTGGGACACTGGAATTTATCTGCTCTATAGTCAG - UNI16303 - - UNI30878 - - UNI31287 - GTCCTGTTTC

ATGATGTGACTTTCACAATGGGTCAGGTGGTATCTCGGGAAGGACAAGGGAGAAGAGAAACTCTATTCCGATGTATCAGAAGTATGCCTTCTGATCCTGA

CCGTGCCTACAATAGCTGCTACAGTGCAG - UNI30878 - GTGTCTTTCATTTACATCAAGGGGATATTATCACTGTCAAAATTCCACGGGCAAACG

CAAAACTTAGCCTTTCTCCGCATGGAACATTCCTGGGGTTTGTGAAACTATGATTGTTATAAAGGGGGTGGGGATTTCCCATTCCAAAAACTGGCTAGAC

AAAGGACAAGGAACGGTCAAGAACAGCTCTCCATGGCTTTGCCTTGACTGTTGTTCCTCCCTTTGCCTTTCCCGCTCCCACTATCTGGGCTTTGACTCCA

TGGATATTAAAAAAGTAGAATATTTTGTGTTTATCTCCCACACAGCCCCAAATTCTTTTGTTGTGTGTGCGAAGGGGGTTTTGCGCACTGTGCCAAGCCT

TGTCCACTGGAATGCATCCAGAACAGCAGCACCATCTAGCGGCAGGTTGAGGAAAGACTATGGTCTCTGCTAGGGAAAACCTTATCCAACTCTTCAAGTA

CCCTCTGCTTCAATTAACAAGAAGCCCGGCTTTCAGTATTTC
Translation
MPASSPGHMGGSVREPALSVALWLSWGAVLGAVTCAVALLIQQTELQSLRREVSRLQRSGGPSQKQGERPWQSLWEQ - UNI14358 - - UNI3000

1 - SPDVLEAWKDGAKSRRRRAVLTQKHKK - UNI12927 - - UNI14358 - - UNI31287 - KKHSVLHLVPVNITSKD - UNI31287 

- DSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQ - UNI16303 - - UNI30878 - - UNI31287 - VLFHDVTFTMGQVVSREGQ

GRRETLFRCIRSMPSDPDRAYNSCYSAG - UNI30878 - GVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
Transcript ENSMUST00000102587
Sequence
TGCGGTCGCCTGCCTGCACGCGCCCGGGCGCAGGACGTCTCTTACTTCTTGCACAGCACTCCGGGGAGGTTGGAGTTTAATCACACAAACAGTGTCCGGC

TTCCTGTCCTCATCCGCCCCCCCTCCGGCCCGCTTCCCTGGTCCCTCCCTCTCCCCTGGCCCGATCCGCCCACCAGCTCCCCCTCCCCATCCCTCGGGTC

CCGGGATGGGGGGGCGGTGAGGCAGGCACAGCCCCCCGCCCCCATGGCCGCCCGTCGGAGCCAGAGGCGGAGGGGGCGCCGGGGGGAGCCGGGCACCGCC

CTGCTGGCCCCGCTGGTGCTGAGCCTGGGCCTGGCGCTGGCCTGCCTTGGCCTCCTGCTGGTCGTGGTCAGCCTGGGGAGCTGGGCAACGCTGTCTGCCC

AG - UNI17242 - GAGCCTTCTCAGGAGGAGCTGACAGCAGAGGACCGCCGGGAGCCCCCT - UNI17242 - - UNI22491 - GAACTGAAT

CCCCAGACAGAGGAAAGCCAGGATGTGGTACCTTTCTTGGAACAACTAGTCCGGCCTCGAAGAAGTG - UNI8554 - CTCCTAAAGGCCGGAAGGCG

CGGCCTCGCCGAGCTATTGCAGCCCATTATGAGG - UNI13018 - TTCATCCTCGGCCAGGACAGGATGGAGCACAAGCAG - UNI21090 - GT

GTGGATGGGACAGTGAGTGGCTGGGAAGAGACCAAAATCAACAGCTCCAGCCCTCTGCGCTACGACCGCCAGATTGGGGAATTTACAGTCATCAGGGCTG

GGCTCTACTACCTGTACTGTCAG - UNI19360 - - UNI30001 - - UNI30460 - GTGCACTTTGATGAGGGAAAGGCTGTCTACCTGAAGC

TGGACTTGCTGGTGAACGGTGTGCTGGCCCTGCGCTGCCTGGAAGAATTCTCAGCCACAGCAGCAAGCTCTCCTGGGCCCCAGCTCCGTTTGTGCCAGGT

GTCTGGGCTGTTGCCGCTGCGGCCAGGGTCTTCCCTTCGGATCCGCACCCTCCCCTGGGCTCATCTTAAGGCTGCCCCCTTCCTAACCTACTTTGGACTC

TTTCAAGTTCACTGA
Translation
MAARRSQRRRGRRGEPGTALLAPLVLSLGLALACLGLLLVVVSLGSWATLSAQ - UNI17242 - EPSQEELTAEDRREPP - UNI17242 - - U

NI22491 - ELNPQTEESQDVVPFLEQLVRPRRSA - UNI8554 - APKGRKARPRRAIAAHYEV - UNI13018 - VHPRPGQDGAQAG - UN

I21090 - GVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQ - UNI19360 - - UNI30001 - - UNI30460 - VHFDEGKAV

YLKLDLLVNGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH

For any suggestions or comments, please send an email to unitrap@crg.es