Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000018765 (Fxr2)
Chromosomal location
Chr 11: 69446463 - 69466799 (+)
Description
fragile X mental retardation, autosomal homolog 2 Gene [Source:MGI (curated);Acc:Fxr2-006]
RefSeq_dna
NM_011814 
RefSeq_peptide
NP_035944.2 
UniGene
Mm.41930 
MGI
MGI:1346074 
Uniprot/SWISSPROT
Q9WVR4 
Uniprot/SPTREMBL
Q3TA75 Q6P5B5 
Human Ortholog
ENSG00000129245 (FXR2)
Omim not available
UniTrap UNI10357
Vector Insertion
Chr 11: 69446462 - 69446901
Public Clones XB019A (baygenomics) XB031 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4636
Vector Insertion
Chr 11: 69453830 - 69454783
Public Clones AR0051 (sanger)
Private Clones OST136533 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7317
Vector Insertion
Chr 11: 69457457 - 69462306
Public Clones RRU006 (baygenomics)
Private Clones OST224651 (lexicon)
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4476
Vector Insertion
Chr 11: 69462478 - 69462651
Public Clones AA0024 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108655
Sequence
CGGCAGCAGGGGGAGGTGGAGGCCGTGGAGCGGCAGCGGCGGGTCCCGGGACCGAGGCAGCAGCGGGGGCGCCGGCGGGCGGAAGCTGAGGTGACGAAGG

CGGCGGCGGCGGCGGCGGCCGTTTCCCTCACGGTGGCGGAGACCAAGGCAGCGGCGGCGGCGGCGGACGGGGAGCGGCCCGGCCCCGGCCCCCTGCTCGT

CGGCTGTAGCAGGGCCGCCGTGGGGCCGGCCCGGCTCCCGCCCCCCGCGGCTCCCCCTCCGGCTCCTCCTCCAGGGAGACGCCGGGGACCCGGCCCGGCC

CGCACTCAGGGCTCTGTTTCAGCTGCTGCCGGGCCAGTCGGAGGTGGTGGCGGCGCCATGGGCGGCCTGGCCTCTGGGGGGGATGTGGAGCCGGGACTGC

CCGTCGAGGTGCGGGGCTCCAACGGGGCCTTCTACAAG - UNI10357 - GGCTTTGTAAAGGATGTCCATGAAGACTCTGTCACTATCTTCTTTGAG

AACAA CTGGCAGAGTGAGAGACAGATTCCCTTTGGGGATGTCCGACTACCGCCTCCAGCTGACTACAATAAGGAAATCACAGAAGGAGATGAAGTAGAG

 - UNI4636 - GTCTATTCGAGAGCCAATGAACAGGAACCTTGTGGCTGGTGGCTGGCCCGGGTGCGGATGATGAAGGGAGAT TTCTATGTCATTGA

GTACGCTGCCTGTGATGCTACCTACAATGAGATTGTCACTCTGGAACGACTTCGGCCAGTCAATCCCAGTCCCCTTGCAACCAAAGGCAGCTTCTTCAAG

GTTACCATGGCTGTGCCTGAGGACCTCAGGGAGGC CTGCTCCAATGAAAATGTCCATAAGGAGTTCAAGAAAGCACTGGGAGCCAACTGCATCTTTCTC

AACATCACAAACAGTGAGCTCTTTATTCTG TCAACCACAGAAGCCCCTGTGAAGAGGGCATCTTTGTTGGGTGATATGCATTTCCGAAGCCTTCGCACC

AAATTGCTGCTCATGTCCCGCAATGAAGAAGCTACTAAGCACCTAGAG - UNI7317 - ACAAGTAAGCAGCTGGCAGCAGCCTTCCAAGAGGAGTTC

ACAGTGCGAGAGGACCTGATGGGTCTGGCGATCGGAACGCACGGTGCCAACATCCAGCAGGCTCGGAAAGTGCCCGGAGTGACTGCCATTGAGTTGGGTG

AAGAGACCTGCACTTTCCGAATCTATGGGGAG - UNI4476 - ACACCAGAGGCATGCAGACAGGCTCGAAGCTACCTTGAATTTTCCGAGGACTCTG

TACAAGTGCCCAGGAACCTGGTTG GCAAAGTGATCGGAAAGAACGGGAAAGTGATTCAGGAGATTGTGGATAAGTCTGGTGTGGTGAGGGTTCGTGTGG

AAGGAGATAACGACAAGAAGAACCCCAGGGAGGAG GGAATGGTTCCCTTCATATTTGTTGGCACCCGAGAGAACATCAGCAATGCCCAGGCACTGCTTG

AGTATCACCTCTCCTACCTGCAG GAGGTTGAACAGCTTCGCCTGGAGAGACTGCAGATTGACGAACAGCTTCGGCAGATTGGGCTGGGCTTTCGCCCTC

CTGGGAGTGGACGGGGTGGCAGTGGTGGTGGCAGTGACAAGGCGGGCTATACCACAGACGAAAGCTCCTCCTCTTCCCTGCACACGACCAGAACCTATGG

GGGCAGCTATGGGGGCCGGGGCCGGGGCCGGAGGACTGGTGGTCCTGCCTATG GCCCCAGCTCAGACCCCTCCACAGCTTCAGAGACAGAGTCAGAAAA

GAGAGAGGAGTCTAATCGAGCAGGACCTGGTGACAGAGATCCCCCAAGCCGTGGAGAAGAAAGCAGGAGGCGGCCGATTGGGGGCCGGGGAAGGGGACCC

CCACCTGTTCCCCGGCCTACCTCAAGATATAACTCATCATCTATTAGCTCAG TGCTAAAGGATCCAGACAGCAATCCTTACAGCCTCTTGGACACATCT

GAACCAGAGCCTCCAGTTGATTCGGAGCCTGGTGAACCTCCTCCAGCAAGTGCCCGTCGTCGCCGTTCCCGCCGCCGCCGTACTGATGAAGACAGGACTG

TCATGGACGGAGGCCTGGAGTCTGATGGTCCTAACATGACAGAGAATGGCCTGG AAGATGAATCAAGACCCCAGAGACGAAATCGCAGCCGCCGCCGCC

GTAATCGTGGTAACCGGACTGATGGGTCCATCAGTGGAGACCGCCAACCAG TGACTGTGGCTGACTATATCTCACGGGCAGAGTCTCAGAGCCGCCAGC

GGCCCCTGGAACGCACGAAACCCTCAGAGGATTCTCTTTCAGGACAGAAG GGTGACTCTGTCAGCAAGCTTCCCAAGGGCCCCTCAGAGAATGGGGAGC

TCTCTGCCCCCTTGGAGTTGGGTAGTTTGGTGAATGGAGTTTCATAAAACCTCCGGTCCACATCCCTCCTTTCTCCATCTCGCTTGCTGCCCACCACCAT

GGCCCTCATGGGTCCAACTGACCTGCGCTGGAGCTGCTCTTATCTACGGGGGAGGGGGGTGGCACAGCAGCTTGGGTCCCCCCCAACCTCCAGGAGCTAG

TGGAGGGGTGTGTAACAGGGTCATACCCCTCCCTCTTGTCCACCCTACCCCCAGGGTGAGGGAGCCTCCCCTTCCCTTTCAGACTGGATGTGCCTTTATC

CTCTAATGCCCCGACCTCTGAACACCCCCATTCTCCGCCTGTTGGTGGGGGTGCTCCTTGACCCACCCAGATTTGACAGTTCAGGGGGGCTCCCCTGCTA

TCCCTCCTCCCATCCTGTACCCCCCATTTCTGGGGCCTCATCACTGTGGAAGACGGGGATAGTGAGGGTATTCGTGGGTGGGAGGCATGGGGAAGGTTTT

GGAATAGAACCAGGGGTATGTATGAAGGGGGGTGACAAGGTCTCCCAGGGGAGTTGGGAGGAAATAACCTTGTCTGGTGGATGAGAAGGCGTATTTATTT

TTCACTGTACAGTATTTAAAAAGAGAATAAAAAAATCCAAATGGC
Translation
RQQGEVEAVERQRRVPGPRQQRGRRRAEAEVTKAAAAAAAVSLTVAETKAAAAAADGERPGPGPLLVGCSRAAVGPARLPPPAAPPPAPPPGRRRGPGPA

RTQGSVSAAAGPVGGGGGAMGGLASGGDVEPGLPVEVRGSNGAFYK - UNI10357 - GFVKDVHEDSVTIFFENN NWQSERQIPFGDVRLPPPADY

NKEITEGDEVE - UNI4636 - VYSRANEQEPCGWWLARVRMMKGD FYVIEYAACDATYNEIVTLERLRPVNPSPLATKGSFFKVTMAVPEDLREA 

ACSNENVHKEFKKALGANCIFLNITNSELFIL STTEAPVKRASLLGDMHFRSLRTKLLLMSRNEEATKHLE - UNI7317 - TSKQLAAAFQEEFTV

REDLMGLAIGTHGANIQQARKVPGVTAIELGEETCTFRIYGE - UNI4476 - TPEACRQARSYLEFSEDSVQVPRNLVG GKVIGKNGKVIQEIVDK

SGVVRVRVEGDNDKKNPREE GMVPFIFVGTRENISNAQALLEYHLSYLQ EVEQLRLERLQIDEQLRQIGLGFRPPGSGRGGSGGGSDKAGYTTDESSS

SSLHTTRTYGGSYGGRGRGRRTGGPAYG GPSSDPSTASETESEKREESNRAGPGDRDPPSRGEESRRRPIGGRGRGPPPVPRPTSRYNSSSISSV VLK

DPDSNPYSLLDTSEPEPPVDS   
Transcript ENSMUST00000018909
Sequence
GGGAGGTGGAGGCCGTGGAGCGGCAGCGGCGGGTCCCGGGACCGAGGCAGCAGCGGGGGCGCCGGCGGGCGGAAGCTGAGGTGACGAAGGCGGCGGCGGC

GGCGGCGGCCGTTTCCCTCACGGTGGCGGAGACCAAGGCAGCGGCGGCGGCGGCGGACGGGGAGCGGCCCGGCCCCGGCCCCCTGCTCGTCGGCTGTAGC

AGGGCCGCCGTGGGGCCGGCCCGGCTCCCGCCCCCCGCGGCTCCCCCTCCGGCTCCTCCTCCAGGGAGACGCCGGGGACCCGGCCCGGCCCGCACTCAGG

GCTCTGTTTCAGCTGCTGCCGGGCCAGTCGGAGGTGGTGGCGGCGCCATGGGCGGCCTGGCCTCTGGGGGGGATGTGGAGCCGGGACTGCCCGTCGAGGT

GCGGGGCTCCAACGGGGCCTTCTACAAG - UNI10357 - GGCTTTGTAAAGGATGTCCATGAAGACTCTGTCACTATCTTCTTTGAGAACAA CTGG

CAGAGTGAGAGACAGATTCCCTTTGGGGATGTCCGACTACCGCCTCCAGCTGACTACAATAAGGAAATCACAGAAGGAGATGAAGTAGAG - UNI4636

 - GTCTATTCGAGAGCCAATGAACAGGAACCTTGTGGCTGGTGGCTGGCCCGGGTGCGGATGATGAAGGGAGAT TTCTATGTCATTGAGTACGCTGCC

TGTGATGCTACCTACAATGAGATTGTCACTCTGGAACGACTTCGGCCAGTCAATCCCAGTCCCCTTGCAACCAAAGGCAGCTTCTTCAAGGTTACCATGG

CTGTGCCTGAGGACCTCAGGGAGGC CTGCTCCAATGAAAATGTCCATAAGGAGTTCAAGAAAGCACTGGGAGCCAACTGCATCTTTCTCAACATCACAA

ACAGTGAGCTCTTTATTCTG TCAACCACAGAAGCCCCTGTGAAGAGGGCATCTTTGTTGGGTGATATGCATTTCCGAAGCCTTCGCACCAAATTGCTGC

TCATGTCCCGCAATGAAGAAGCTACTAAGCACCTAGAG - UNI7317 - ACAAGTAAGCAGCTGGCAGCAGCCTTCCAAGAGGAGTTCACAGTGCGAG

AGGACCTGATGGGTCTGGCGATCGGAACGCACGGTGCCAACATCCAGCAGGCTCGGAAAGTGCCCGGAGTGACTGCCATTGAGTTGGGTGAAGAGACCTG

CACTTTCCGAATCTATGGGGAG - UNI4476 - ACACCAGAGGCATGCAGACAGGCTCGAAGCTACCTTGAATTTTCCGAGGACTCTGTACAAGTGCC

CAGGAACCTGGTTG GCAAAGTGATCGGAAAGAACGGGAAAGTGATTCAGGAGATTGTGGATAAGTCTGGTGTGGTGAGGGTTCGTGTGGAAGGAGATAA

CGACAAGAAGAACCCCAGGGAGGAG GGAATGGTTCCCTTCATATTTGTTGGCACCCGAGAGAACATCAGCAATGCCCAGGCACTGCTTGAGTATCACCT

CTCCTACCTGCAG GAGGTTGAACAGCTTCGCCTGGAGAGACTGCAGATTGACGAACAGCTTCGGCAGATTGGGCTGGGCTTTCGCCCTCCTGGGAGTGG

ACGGGGTGGCAGTGGTGGTGGCAGTGACAAGGCGGGCTATACCACAGACGAAAGCTCCTCCTCTTCCCTGCACACGACCAGAACCTATGGGGGCAGCTAT

GGGGGCCGGGGCCGGGGCCGGAGGACTGGTGGTCCTGCCTATG GCCCCAGCTCAGACCCCTCCACAGCTTCAGAGACAGAGTCAGAAAAGAGAGAGGAG

TCTAATCGAGCAGGACCTGGTGACAGAGATCCCCCAAGCCGTGGAGAAGAAAGCAGGAGGCGGCCGATTGGGGGCCGGGGAAGGGGACCCCCACCTGTTC

CCCGGCCTACCTCAAGATATAACTCATCATCTATTAGCTCAG TGCTAAAGGATCCAGACAGCAATCCTTACAGCCTCTTGGACACATCTGAACCAGAGC

CTCCAGTTGATTCGGAGCCTGGTGAACCTCCTCCAGCAAGTGCCCGTCGTCGCCGTTCCCGCCGCCGCCGTACTGATGAAGACAGGACTGTCATGGACGG

AGGCCTGGAGTCTGATGGTCCTAACATGACAGAGAATGGCCTGG AAGATGAATCAAGACCCCAGAGACGAAATCGCAGCCGCCGCCGCCGTAATCGTGG

TAACCGGACTGATGGGTCCATCAGTGGAGACCGCCAACCAG TGACTGTGGCTGACTATATCTCACGGGCAGAGTCTCAGAGCCGCCAGCGGCCCCTGGA

ACGCACGAAACCCTCAGAGGATTCTCTTTCAGGACAGAAG GGTGACTCTGTCAGCAAGCTTCCCAAGGGCCCCTCAGAGAATGGGGAGCTCTCTGCCCC

CTTGGAGTTGGGTAGTTTGGTGAATGGAGTTTCATAAAACCTCCGGTCCACATCCCTCCTTTCTCCATCTCGCTTGCTGCCCACCACCATGGCCCTCATG

GGTCCAACTGACCTGCGCTGGAGCTGCTCTTATCTACGGGGGAGGGGGGTGGCACAGCAGCTTGGGTCCCCCCCAACCTCCAGGAGCTAGTGGAGGGGTG

TGTAACAGGGTCATACCCCTCCCTCTTGTCCACCCTACCCCCAGGGTGAGGGAGCCTCCCCTTCCCTTTCAGACTGGATGTGCCTTTATCCTCTAATGCC

CCGACCTCTGAACACCCCCATTCTCCGCCTGTTGGTGGGGGTGCTCCTTGACCCACCCAGATTTGACAGTTCAGGGGGGCTCCCCTGCTATCCCTCCTCC

CATCCTGTACCCCCCATTTCTGGGGCCTCATCACTGTGGAAGACGGGGATAGTGAGGGTATTCGTGGGTGGGAGGCATGGGGAAGGTTTTGGAATAGAAC

CAGGGGTATGTATGAAGGGGGGTGACAAGGTCTCCCAGGGGAGTTGGGAGGAAATAACCTTGTCTGGTGGATGAGAAGGCGTATTTATTTTTCACTGTAC

AGTATTTAAAAAGAGAATAAAAAAATCCAAATGGC
Translation
MGGLASGGDVEPGLPVEVRGSNGAFYK - UNI10357 - GFVKDVHEDSVTIFFENN NWQSERQIPFGDVRLPPPADYNKEITEGDEVE - UNI46

36 - VYSRANEQEPCGWWLARVRMMKGD FYVIEYAACDATYNEIVTLERLRPVNPSPLATKGSFFKVTMAVPEDLREA ACSNENVHKEFKKALGANC

IFLNITNSELFIL STTEAPVKRASLLGDMHFRSLRTKLLLMSRNEEATKHLE - UNI7317 - TSKQLAAAFQEEFTVREDLMGLAIGTHGANIQQA

RKVPGVTAIELGEETCTFRIYGE - UNI4476 - TPEACRQARSYLEFSEDSVQVPRNLVG GKVIGKNGKVIQEIVDKSGVVRVRVEGDNDKKNPRE

E GMVPFIFVGTRENISNAQALLEYHLSYLQ EVEQLRLERLQIDEQLRQIGLGFRPPGSGRGGSGGGSDKAGYTTDESSSSSLHTTRTYGGSYGGRGRG

RRTGGPAYG GPSSDPSTASETESEKREESNRAGPGDRDPPSRGEESRRRPIGGRGRGPPPVPRPTSRYNSSSISSV VLKDPDSNPYSLLDTSEPEPPV

DSEPGEPPPASARRRRSRRRRTDEDRTVMDGGLESDGPNMTENGLE EDESRPQRRNRSRRRRNRGNRTDGSISGDRQPV VTVADYISRAESQSRQRPL

ERTKPSEDSLSGQK GDSVSKLPKGPSENGELSAPLELGSLVNGVS

For any suggestions or comments, please send an email to unitrap@crg.es