Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000018796 (Acsl1)
Chromosomal location
Chr 8: 47556396 - 47621404 (+)
Description
acyl-CoA synthetase long-chain family member 1 Gene [Source:MGI (curated);Acc:Acsl1-001]
RefSeq_dna
NM_007981 
RefSeq_peptide
NP_032007.2 
UniGene
Mm.398595 
MGI
MGI:102797 
Uniprot/SWISSPROT
P41216 
Uniprot/SPTREMBL
Q6GTG6 
Human Ortholog
ENSG00000151726 (ACSL1)
Omim not available
UniTrap UNI24400
Vector Insertion
Chr 8: 47578185 - 47578381
Public Clones not available
Private Clones OST222102 (lexicon) OST67212 (lexicon) OST56743 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110371
Sequence
ATGGAAGTCCATGAATTGTTCCGGTATTTTCGAATGCCAGAGCTGATTGACATTCGGCAGTACGTGCGCACCCTTCCAACCAACACCCTCATGGGGTTTG

GGGCTTTTGCAGCGCTCACCACCTTCTGGTATGCCACCAGGCCTAAGGCCCTGAAGCCACCATGTGACCTCTCCATGCAGTCAGTGGAAATAGCG - UN

I24400 - GGTACCACTGATGGTATTCGAAGATCAGCAGTCCTTGAAGATGACAAGCTCTTGGTGTACTACTACGACGATGTCAGAACCATGTACGATG

GCTTCCAGAGGGGGATTCAGGTGTCAA ATAATGGTCCTTGTTTAGGTTCTCGGAAGCCAAACCAGCCCTATGAGTGGATTTCCTACAAAGAG GTGGCA

GAACTGGCTGAGTGCATAGGCTCCGGGCTGATCCAGAAGGGGTTCAAGCCTTGCTCCGAGCAGTTCATCGGCCTCTTCTCTCAAAACAGACCCGAG TGG

GTGATCGTCGAGCAAGGATGCTTCTCTTACTCAATGGTGGTCGTCCCGCTCTATGACACCCTTGGAGCTGACGCCATCACCTACATAGTGAACAAAG CT

GAACTCTCTGTGATTTTTGCTGACAAGCCAGAAAAAGCCAAACTCTTATTAGAAGGTGTAGAAAACAAGTTAACACCATGCCTTAAAATCATAGTCATCA

TGGACTCCTACGGCAGTGATCTGGTGGAACGAGGCAAGAAGTGTGGGGTGGAAATCATCAGCCTCAAAGCTCTGGAG GACCTTGGAAGAGTGAACAGAG

TGAAGCCCAAG CCTCCAGAACCCGAAGATCTTGCGATAATTTGTTTCACAAGTGGAACTACAG GCAACCCCAAAGGAGCAATGATCACTCACCAAAAC

ATTATAAACGACTGCTCAGGTTTTATAAAAGCAACAGAG AGTGCACTGACCTTGAATGCCAGTGACACACAGATTTCCTACTTACCACTGGCACACATG

TATGAGCAGCAGCTCCAG TGTGTAATGCTGTGTCATGGAGCTAAGATAGGATTTTTCCAAGGAGATATCAGGCTGCTTATGGACGACCTCAAGGTGCTT

CAGCCCACCATCTTCCCTGTGGTTCCCAGGCTGCTGAACCGGATGTTCGACAGA ATTTTTGGACAAGCAAACACTTCCTTGAAGCGATGGCTGTTGGAC

TTTGCCTCCAAAAGGAAAGAGGCGGAGCTTCGCAGTGGCATCGTCAGAAACAACAGCCTGTGGGATAAACTCATCTTCCACAAGATACAG TCGAGCCTG

GGTGGGAAAGTCCGGCTGATGATCACAGGAGCAGCCCCGGTGTCTGCCACAGTGCTGACGTTTCTGAGGACAGCGCTCGGCTGCCAG TTCTATGAAGGC

TACGGACAGACCGAGTGCACTGCTGGTTGCTGCCTGAGCTTGCCCGGAGACTGGACGGCAG GCCATGTTGGAGCCCCCATGCCTTGCAATTATGTAAAG

CTTGTGGATGTGGAAGAAATGAATTACCTGGCATCCAAGGGCGAGGGTGAG GTGTGTGTGAAAGGGGCAAATGTGTTCAAAGGCTACTTGAAAGACCCA

GCAAGAACAGCTGAAGCCCTGGATAAAGATGGCTGGTTACACACGGGGGACATTGGAAAATGGCTGCCA AATGGCACCTTGAAGATTATCGACAGGAAA

AAGCACATATTTAAACTAGCCCAAGGAGAGTACATAGCACCAGAAAAGATTGAAAATATCTACCTGCGGAGTGAAGCCGTGGCCCAGGTGTTTGTCCACG

GAGAAAGCTTGCAG GCCTTTCTCATAGCAGTTGTGGTACCCGACGTTGAGAGCCTACCGTCCTGGGCACAGAAGAGAGGCTTACAAGGGTCCTTCGAAG

AACTGTGCAGGAACAAG GATATCAATAAAGCTATCCTGGACGACTTGTTGAAACTTGGGAAGGAAGCCGGTCTGAAGCCATTTGAACAG GTCAAAGGC

ATTGCTGTGCACCCGGAATTATTTTCTATTGACAACGGCCTTCTGACTCCAACACTGAAGGCGAAGAGGCCAGAGCTACGGAACTATTTCAGGTCGCAGA

TAGATGAACTGTACGCCACCATCAAGATCTAA
Translation
MEVHELFRYFRMPELIDIRQYVRTLPTNTLMGFGAFAALTTFWYATRPKALKPPCDLSMQSVEIA - UNI24400 - GTTDGIRRSAVLEDDKLLVYY

YDDVRTMYDGFQRGIQVSN NNGPCLGSRKPNQPYEWISYKE VAELAECIGSGLIQKGFKPCSEQFIGLFSQNRPE WVIVEQGCFSYSMVVVPLYDTL

GADAITYIVNKA AELSVIFADKPEKAKLLLEGVENKLTPCLKIIVIMDSYGSDLVERGKKCGVEIISLKALE DLGRVNRVKPK PPEPEDLAIICFTS

GTTG GNPKGAMITHQNIINDCSGFIKATE SALTLNASDTQISYLPLAHMYEQQLQ CVMLCHGAKIGFFQGDIRLLMDDLKVLQPTIFPVVPRLLNRM

FDR IFGQANTSLKRWLLDFASKRKEAELRSGIVRNNSLWDKLIFHKIQ SSLGGKVRLMITGAAPVSATVLTFLRTALGCQ FYEGYGQTECTAGCCLS

LPGDWTAG GHVGAPMPCNYVKLVDVEEMNYLASKGEGE VCVKGANVFKGYLKDPARTAEALDKDGWLHTGDIGKWLP NGTLKIIDRKKHIFKLAQGE

YIAPEKIENIYLRSEAVAQVFVHGESLQ AFLIAVVVPDVESLPSWAQKRGLQGSFEELCRNK DINKAILDDLLKLGKEAGLKPFEQ VKGIAVHPELF

SIDNGLLTPTLKAKRPELRNYFRSQIDELYATIKI
Transcript ENSMUST00000110372
Sequence
TAGTTACCTTTAGCCCAGTGGGCAGCGGTGTAGGACTCGGCATGTGACAAATGCCCTGAAAGACCTTGGCAGGCCTGGTAAGCACCCGCTGAGCTGCCCT

GGCCCCCACCCCACCCCCAGCCTCACTGCCCTTTTCTGATTCTGCTGCGGTGTGTCACCTAGCAGTCAGCTGTCGGATGGCACAGATG AATTCTGCATA

GAGAACCACCAACCCAGAACCATGGAAGTCCATGAATTGTTCCGGTATTTTCGAATGCCAGAGCTGATTGACATTCGGCAGTACGTGCGCACCCTTCCAA

CCAACACCCTCATGGGGTTTGGGGCTTTTGCAGCGCTCACCACCTTCTGGTATGCCACCAGGCCTAAGGCCCTGAAGCCACCATGTGACCTCTCCATGCA

GTCAGTGGAAATAGCG - UNI24400 - GGTACCACTGATGGTATTCGAAGATCAGCAGTCCTTGAAGATGACAAGCTCTTGGTGTACTACTACGACG

ATGTCAGAACCATGTACGATGGCTTCCAGAGGGGGATTCAGGTGTCAA ATAATGGTCCTTGTTTAGGTTCTCGGAAGCCAAACCAGCCCTATGAGTGGA

TTTCCTACAAAGAG GTGGCAGAACTGGCTGAGTGCATAGGCTCCGGGCTGATCCAGAAGGGGTTCAAGCCTTGCTCCGAGCAGTTCATCGGCCTCTTCT

CTCAAAACAGACCCGAG TGGGTGATCGTCGAGCAAGGATGCTTCTCTTACTCAATGGTGGTCGTCCCGCTCTATGACACCCTTGGAGCTGACGCCATCA

CCTACATAGTGAACAAAG CTGAACTCTCTGTGATTTTTGCTGACAAGCCAGAAAAAGCCAAACTCTTATTAGAAGGTGTAGAAAACAAGTTAACACCAT

GCCTTAAAATCATAGTCATCATGGACTCCTACGGCAGTGATCTGGTGGAACGAGGCAAGAAGTGTGGGGTGGAAATCATCAGCCTCAAAGCTCTGGAG G

ACCTTGGAAGAGTGAACAGAGTGAAGCCCAAG CCTCCAGAACCCGAAGATCTTGCGATAATTTGTTTCACAAGTGGAACTACAG GCAACCCCAAAGGA

GCAATGATCACTCACCAAAACATTATAAACGACTGCTCAGGTTTTATAAAAGCAACAGAG AGTGCATTCATCGCTTCCACAGATGATGTGCTGATATCT

TTCTTGCCTCTCGCCCATATGTTTGAGACCGTTGTAGAG TGTGTAATGCTGTGTCATGGAGCTAAGATAGGATTTTTCCAAGGAGATATCAGGCTGCTT

ATGGACGACCTCAAGGTGCTTCAGCCCACCATCTTCCCTGTGGTTCCCAGGCTGCTGAACCGGATGTTCGACAGA ATTTTTGGACAAGCAAACACTTCC

TTGAAGCGATGGCTGTTGGACTTTGCCTCCAAAAGGAAAGAGGCGGAGCTTCGCAGTGGCATCGTCAGAAACAACAGCCTGTGGGATAAACTCATCTTCC

ACAAGATACAG TCGAGCCTGGGTGGGAAAGTCCGGCTGATGATCACAGGAGCAGCCCCGGTGTCTGCCACAGTGCTGACGTTTCTGAGGACAGCGCTCG

GCTGCCAG TTCTATGAAGGCTACGGACAGACCGAGTGCACTGCTGGTTGCTGCCTGAGCTTGCCCGGAGACTGGACGGCAG GCCATGTTGGAGCCCCC

ATGCCTTGCAATTATGTAAAGCTTGTGGATGTGGAAGAAATGAATTACCTGGCATCCAAGGGCGAGGGTGAG GTGTGTGTGAAAGGGGCAAATGTGTTC

AAAGGCTACTTGAAAGACCCAGCAAGAACAGCTGAAGCCCTGGATAAAGATGGCTGGTTACACACGGGGGACATTGGAAAATGGCTGCCA AATGGCACC

TTGAAGATTATCGACAGGAAAAAGCACATATTTAAACTAGCCCAAGGAGAGTACATAGCACCAGAAAAGATTGAAAATATCTACCTGCGGAGTGAAGCCG

TGGCCCAGGTGTTTGTCCACGGAGAAAGCTTGCAG GCCTTTCTCATAGCAGTTGTGGTACCCGACGTTGAGAGCCTACCGTCCTGGGCACAGAAGAGAG

GCTTACAAGGGTCCTTCGAAGAACTGTGCAGGAACAAG GATATCAATAAAGCTATCCTGGACGACTTGTTGAAACTTGGGAAGGAAGCCGGTCTGAAGC

CATTTGAACAG GTCAAAGGCATTGCTGTGCACCCGGAATTATTTTCTATTGACAACGGCCTTCTGACTCCAACACTGAAGGCGAAGAGGCCAGAGCTAC

GGAACTATTTCAGGTCGCAGATAGATGAACTGTACGCCACCATCAAGATCTAACGTGAGGAAGGATACTTAGAAGAAATGGCGCATCTCCACAATCCTCC

TCGTACCAATGGCCTTCGAGTTGGTAACTTTGCCTGCAGCGAGTGTGGGAAAGGAAATGCCCTGCCGCCGGACTTGTCCACGGGGTCTTACCATAGGGAT

AGTCGAGGGCACGGAACACTGCCTTACTTACAGTCACCTGTGTTGCAGCCCATGATCCCGGGGACACACAATTTCCAAAACGAGCCTTAAACATTGTAAA

GGGGAACCCATAAAAGTGCTAAGTTATTTAAGACTTCTTCAACCAATAAGGTGGATGCTACAAGTTCTGTCTCCTGTTTTTCTAACTGAGGGGTTAGGAC

TTATTCTTTCTGATATGTCTGCTGCTTGCTGCGCGTTTTGCAGCTGTCTGCTGCTCTGAAGAGCACCGTACACTGGAGGAAAGCTGTCCCTTTAAGAACA

ACTGTCCAGGCTGAAGAAAGTCACAGTGGACCAGAGGTTTTCCTTTTGAACCCCTCCTCCCCCTTGCCCCTTTCCCTCACCACCTCACATACAGTACACT

CACATGACCTTTCTGGTTTGTAAGGGTTCCACACGGTCCCTGTTTGCGCCTGCTGGAACATGAGGTTTTCAGTAAACTAAAGAGCAGACCCTCTTCAGAA

CATGTGGGTGTCCAGTCTCAGAAAGAAAAAAAAAATGGCGGCTCACTCAAACGTTCTCAGACTCCTCTCCAAATCTGGTCTCCTGCCTCCCTCCCCCTCG

TCCCAGGGGTTATAAGAAATCCTGCCTTAGACTCTGCAATGAAGATGGTATTTCAAAGAACGCCCTGGAGCGGCCATGCTCAACTGTGACATCTCCACCG

CTCTCCACCTGCTCCCTCGTGGAAGCAGCCCATGTTGGTAATGGCCACTGGGCTCCCTCGTGGAAGCAGCCCATGTTGGTAACGGCCACTGGGCTCCCTC

GTGGTTTTCCTGGCAAATGATAATGCGGTGATTACCTTGCTTTTTTTCCCCTCCCAGTTAAACTCAGGCAAAGCATGTCTTCAAAACTATGTAGGGAGCT

GATATACATGGGTACTTATTAAAATGGACAGTAACAAGTAAATATCCTTATTAT
Translation
 MEVHELFRYFRMPELIDIRQYVRTLPTNTLMGFGAFAALTTFWYATRPKALKPPCDLSMQSVEIA - UNI24400 - GTTDGIRRSAVLEDDKLLVY

YYDDVRTMYDGFQRGIQVSN NNGPCLGSRKPNQPYEWISYKE VAELAECIGSGLIQKGFKPCSEQFIGLFSQNRPE WVIVEQGCFSYSMVVVPLYDT

LGADAITYIVNKA AELSVIFADKPEKAKLLLEGVENKLTPCLKIIVIMDSYGSDLVERGKKCGVEIISLKALE DLGRVNRVKPK PPEPEDLAIICFT

SGTTG GNPKGAMITHQNIINDCSGFIKATE SAFIASTDDVLISFLPLAHMFETVVE CVMLCHGAKIGFFQGDIRLLMDDLKVLQPTIFPVVPRLLNR

MFDR IFGQANTSLKRWLLDFASKRKEAELRSGIVRNNSLWDKLIFHKIQ SSLGGKVRLMITGAAPVSATVLTFLRTALGCQ FYEGYGQTECTAGCCL

SLPGDWTAG GHVGAPMPCNYVKLVDVEEMNYLASKGEGE VCVKGANVFKGYLKDPARTAEALDKDGWLHTGDIGKWLP NGTLKIIDRKKHIFKLAQG

EYIAPEKIENIYLRSEAVAQVFVHGESLQ AFLIAVVVPDVESLPSWAQKRGLQGSFEELCRNK DINKAILDDLLKLGKEAGLKPFEQ VKGIAVHPEL

FSIDNGLLTPTLKAKRPELRNYFRSQIDELYATIKI
Transcript ENSMUST00000034046
Sequence
GGGCGGGGCGGCGTGGCACGGCACGCGCACTACCAGCCGCCCGGCCCTGCTGCTGCTGCTGCAACGCCGGTGGCGCAGCCAAGAGAGCAGCTGCGGCCGC

GACTCCTTAAATAGCATCGCAACCCGGCGCGGGGCAGTTCGTGGATTGCAGTGACAGCCGCCTGTGGAGCAGCCCGGGCAGCGGAGGAG AATTCTGCAT

AGAGAACCACCAACCCAGAACCATGGAAGTCCATGAATTGTTCCGGTATTTTCGAATGCCAGAGCTGATTGACATTCGGCAGTACGTGCGCACCCTTCCA

ACCAACACCCTCATGGGGTTTGGGGCTTTTGCAGCGCTCACCACCTTCTGGTATGCCACCAGGCCTAAGGCCCTGAAGCCACCATGTGACCTCTCCATGC

AGTCAGTGGAAATAGCG - UNI24400 - GGTACCACTGATGGTATTCGAAGATCAGCAGTCCTTGAAGATGACAAGCTCTTGGTGTACTACTACGAC

GATGTCAGAACCATGTACGATGGCTTCCAGAGGGGGATTCAGGTGTCAA ATAATGGTCCTTGTTTAGGTTCTCGGAAGCCAAACCAGCCCTATGAGTGG

ATTTCCTACAAAGAG GTGGCAGAACTGGCTGAGTGCATAGGCTCCGGGCTGATCCAGAAGGGGTTCAAGCCTTGCTCCGAGCAGTTCATCGGCCTCTTC

TCTCAAAACAGACCCGAG TGGGTGATCGTCGAGCAAGGATGCTTCTCTTACTCAATGGTGGTCGTCCCGCTCTATGACACCCTTGGAGCTGACGCCATC

ACCTACATAGTGAACAAAG CTGAACTCTCTGTGATTTTTGCTGACAAGCCAGAAAAAGCCAAACTCTTATTAGAAGGTGTAGAAAACAAGTTAACACCA

TGCCTTAAAATCATAGTCATCATGGACTCCTACGGCAGTGATCTGGTGGAACGAGGCAAGAAGTGTGGGGTGGAAATCATCAGCCTCAAAGCTCTGGAG 

GACCTTGGAAGAGTGAACAGAGTGAAGCCCAAG CCTCCAGAACCCGAAGATCTTGCGATAATTTGTTTCACAAGTGGAACTACAG GCAACCCCAAAGG

AGCAATGATCACTCACCAAAACATTATAAACGACTGCTCAGGTTTTATAAAAGCAACAGAG AGTGCATTCATCGCTTCCACAGATGATGTGCTGATATC

TTTCTTGCCTCTCGCCCATATGTTTGAGACCGTTGTAGAG TGTGTAATGCTGTGTCATGGAGCTAAGATAGGATTTTTCCAAGGAGATATCAGGCTGCT

TATGGACGACCTCAAGGTGCTTCAGCCCACCATCTTCCCTGTGGTTCCCAGGCTGCTGAACCGGATGTTCGACAGA ATTTTTGGACAAGCAAACACTTC

CTTGAAGCGATGGCTGTTGGACTTTGCCTCCAAAAGGAAAGAGGCGGAGCTTCGCAGTGGCATCGTCAGAAACAACAGCCTGTGGGATAAACTCATCTTC

CACAAGATACAG TCGAGCCTGGGTGGGAAAGTCCGGCTGATGATCACAGGAGCAGCCCCGGTGTCTGCCACAGTGCTGACGTTTCTGAGGACAGCGCTC

GGCTGCCAG TTCTATGAAGGCTACGGACAGACCGAGTGCACTGCTGGTTGCTGCCTGAGCTTGCCCGGAGACTGGACGGCAG GCCATGTTGGAGCCCC

CATGCCTTGCAATTATGTAAAGCTTGTGGATGTGGAAGAAATGAATTACCTGGCATCCAAGGGCGAGGGTGAG GTGTGTGTGAAAGGGGCAAATGTGTT

CAAAGGCTACTTGAAAGACCCAGCAAGAACAGCTGAAGCCCTGGATAAAGATGGCTGGTTACACACGGGGGACATTGGAAAATGGCTGCCA AATGGCAC

CTTGAAGATTATCGACAGGAAAAAGCACATATTTAAACTAGCCCAAGGAGAGTACATAGCACCAGAAAAGATTGAAAATATCTACCTGCGGAGTGAAGCC

GTGGCCCAGGTGTTTGTCCACGGAGAAAGCTTGCAG GCCTTTCTCATAGCAGTTGTGGTACCCGACGTTGAGAGCCTACCGTCCTGGGCACAGAAGAGA

GGCTTACAAGGGTCCTTCGAAGAACTGTGCAGGAACAAG GATATCAATAAAGCTATCCTGGACGACTTGTTGAAACTTGGGAAGGAAGCCGGTCTGAAG

CCATTTGAACAG GTCAAAGGCATTGCTGTGCACCCGGAATTATTTTCTATTGACAACGGCCTTCTGACTCCAACACTGAAGGCGAAGAGGCCAGAGCTA

CGGAACTATTTCAGGTCGCAGATAGATGAACTGTACGCCACCATCAAGATCTAACGTGAGGAAGGATACTTAGAAGAAATGGCGCATCTCCACAATCCTC

CTCGTACCAATGGCCTTCGAGTTGGTAACTTTGCCTGCAGCGAGTGTGGGAAAGGAAATGCCCTGCCGCCGGACTTGTCCACGGGGTCTTACCATAGGGA

TAGTCGAGGGCACGGAACACTGCCTTACTTACAGTCACCTGTGTTGCAGCCCATGATCCCGGGGACACACAATTTCCAAAACGAGCCTTAAACATTGTAA

AGGGGAACCCATAAAAGTGCTAAGTTATTTAAGACTTCTTCAACCAATAAGGTGGATGCTACAAGTTCTGTCTCCTGTTTTTCTAACTGAGGGGTTAGGA

CTTATTCTTTCTGATATGTCTGCTGCTTGCTGCGCGTTTTGCAGCTGTCTGCTGCTCTGAAGAGCACCGTACACTGGAGGAAAGCTGTCCCTTTAAGAAC

AACTGTCCAGGCTGAAGAAAGTCACAGTGGACCAGAGGTTTTCCTTTTGAACCCCTCCTCCCCCTTGCCCCTTTCCCTCACCACCTCACATACAGTACAC

TCACATGACCTTTCTGGTTTGTAAGGGTTCCACACGGTCCCTGTTTGCGCCTGCTGGAACATGAGGTTTTCAGTAAACTAAAGAGCAGACCCTCTTCAGA

ACATGTGGGTGTCCAGTCTCAGAAAGAAAAAAAAAATGGCGGCTCACTCAAACGTTCTCAGACTCCTCTCCAAATCTGGTCTCCTGCCTCCCTCCCCCTC

GTCCCAGGGGTTATAAGAAATCCTGCCTTAGACTCTGCAATGAAGATGGTATTTCAAAGAACGCCCTGGAGCGGCCATGCTCAACTGTGACATCTCCACC

GCTCTCCACCTGCTCCCTCGTGGAAGCAGCCCATGTTGGTAATGGCCACTGGGCTCCCTCGTGGAAGCAGCCCATGTTGGTAACGGCCACTGGGCTCCCT

CGTGGTTTTCCTGGCAAATGATAATGCGGTGATTACCTTGCTTTTTTTCCCCTCCCAGTTAAACTCAGGCAAAGCATGTCTTCAAAACTATGTAGGGAGC

TGATATACATGGGTACTTATTAAAATGGACAGTAACAAGTAAATATCCTTATTATACAACTACCTGATTTATGTGAAATGCATTTGACAAGCCAAAAATC

TGGGATGAAGAAATCTGAGGGGAATAAAATCATACCCTGGGATTCACTTCCCAAGGTATATATATTTTTTAAGTTAATTTGGGAAATTAACAGCATTTCA

CTTTACTGCAAGTCTTTGCCACATCCGACCTATCCAAGCTGTTGTTTATACATTTGAAGCCACTGTTGTTGGCTGTGTGACAGTGCGTGTGTTATTGAAG

CACAACTGGGTTTGCACTAAAGAATCATCATTGTAATAACACTATTTGGTAGCCTAACTTCATACTCGTATTCTTAATTGCACAGGAAGTCGCTAATTTG

TCACAACGGGGTTTTGAATGTTTGCTTTCAGTGTTGGCTATTTCTATGTTTTATAAACCAAAACAGAATTTCCAAAAACAATGAAGGAAACCAAAATAAA

TATTTCTGCATTTGGAGTGAGTGG
Translation
 MEVHELFRYFRMPELIDIRQYVRTLPTNTLMGFGAFAALTTFWYATRPKALKPPCDLSMQSVEIA - UNI24400 - GTTDGIRRSAVLEDDKLLVY

YYDDVRTMYDGFQRGIQVSN NNGPCLGSRKPNQPYEWISYKE VAELAECIGSGLIQKGFKPCSEQFIGLFSQNRPE WVIVEQGCFSYSMVVVPLYDT

LGADAITYIVNKA AELSVIFADKPEKAKLLLEGVENKLTPCLKIIVIMDSYGSDLVERGKKCGVEIISLKALE DLGRVNRVKPK PPEPEDLAIICFT

SGTTG GNPKGAMITHQNIINDCSGFIKATE SAFIASTDDVLISFLPLAHMFETVVE CVMLCHGAKIGFFQGDIRLLMDDLKVLQPTIFPVVPRLLNR

MFDR IFGQANTSLKRWLLDFASKRKEAELRSGIVRNNSLWDKLIFHKIQ SSLGGKVRLMITGAAPVSATVLTFLRTALGCQ FYEGYGQTECTAGCCL

SLPGDWTAG GHVGAPMPCNYVKLVDVEEMNYLASKGEGE VCVKGANVFKGYLKDPARTAEALDKDGWLHTGDIGKWLP NGTLKIIDRKKHIFKLAQG

EYIAPEKIENIYLRSEAVAQVFVHGESLQ AFLIAVVVPDVESLPSWAQKRGLQGSFEELCRNK DINKAILDDLLKLGKEAGLKPFEQ VKGIAVHPEL

FSIDNGLLTPTLKAKRPELRNYFRSQIDELYATIKI

For any suggestions or comments, please send an email to unitrap@crg.es