Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000018899 (Irf1)
Chromosomal location
Chr 11: 53583553 - 53591876 (+)
Description
interferon regulatory factor 1 Gene [Source:MGI (curated);Acc:Irf1-008]
RefSeq_dna
NM_008390 
RefSeq_peptide
NP_032416.1 
UniGene
Mm.399626 
MGI
MGI:96590 
Uniprot/SWISSPROT
P15314 
Uniprot/SPTREMBL
A8Y5B9 Q4FK18 Q5SX13 Q5SX14 Q5SX15 Q5SX16 Q3U5M1 
Human Ortholog
ENSG00000125347 (IRF1)
Omim 153550 - CHROMOSOME 5q DELETION SYNDROME  
UniTrap UNI24239
Vector Insertion
Chr 11: 53584785 - 53584878
Public Clones not available
Private Clones OST230209 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24278
Vector Insertion
Chr 11: 53586441 - 53587157
Public Clones not available
Private Clones OST226026 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000019043
Sequence
CCCAGAGTGGCCGTCGCGCGCACCCGCGAGCAGCGCCGGGGGACTCGGATGTCCGCCTGCGCGCACTTTTGGCGGTCGCAGCTTGGCTCCCAGCTCTTGC

TTTCGGACGCGCAGTGTTCGGTGCAGAGGTTGGCTCGCTGCCTTGACTGGCTGGACCGGGTCGTGAACTACTGGGCTTTCGGGAGGAGGTGCCACAG - 

UNI24239 - CCACCATGCCAATCACTCGAATGCGGATGAGACCCTGGCTAGAGATGCAGATTAATTCCAACCAAATCCCAGGGCTGATCTGGATCAAT

AAA - UNI24239 - GAAGAGATGATCTTCCAGATTCCATGGAAGCACGCTGCTAAGCACGGCTGGGACATCAACAAGGATGCCTGTCTGTTCCGGAG

CTGGGCCATTCACACAG - UNI24278 - GCCGATACAAAGCAGGAGAAAAAGAGCCAGATCCCAAGACATGGAAGGCAAACTTCCGTTGTGCCATGA

ACTCCCTGCCAGACATCGAGGAAGTGAAGGATCAGAGTAGGAACAAGGGCAGCTCTGCTGTGCGGGTGTACCGGATGCTGCCACCCCTCACCAGGAACCA

GAGGAAAG AGAGAAAGTCCAAGTCCAGCCGAGACACTAAGAGCAAAACCAAGAGGAAG CTGTGTGGAGATGTTAGCCCGGACACTTTCTCTGATGGAC

TCAGCAGCTCTACCCTACCTGATGACCACAGCAGTTACACCACTCAGGGCTACCTGGGTCAGGACTTGGATATGGAAAGGGACATAACTCCAG CACTGT

CACCGTGTGTCGTCAGCAGCAGTCTCTCTGAGTGGCATATGCAGATGGACATTATACCAGATAGCACCACTGATCTGTATAACCTACAGGTGTCACCCAT

GCCTTCCACCTCCGAAG CCGCAACAGACGAGGATGAGGAAGGGAAGATAGCCGAAGACCTTATGAAG CTCTTTGAACAGTCTGAGTGGCAGCCGACAC

ACATCGATGGCAAGGGATACTTGCTCAATGAGCCAGGGACCCAGCTCTCTTCTGTCTATGGAGACTTCAGCTGCAAAGAGGAACCAGAGATTGACAGCCC

TCGAG GGGACATTGGGATAGGCATACAACATGTCTTCACGGAGATGAAGAATATGGACTCCATCATGTGGATGGACAGCCTGCTGGGCAACTCTGTGAG

GCTGCCGCCCTCTATTCAGGCCATTCCTTGTGCACCATAGTTTGGGTCTCTGACCCGTTCTTGCCCTCCTGAGTGAGTTAGGCCTTGGCATCATGGTGGC

TGTGATACAAAAAAAGCTAGACTCCTGTGGGCCCCTTGACACATGGCAAAGCATAGTCCCACTGCAAACAGGGGACCATCCTCCTTGGGTCAGTGGGCTC

TCAGGGCTTAGGAGGCAGAGTCTGAGTTTTCTTGTGAGGTGAAGCTGGCCCTGACTCCTAGGAAGATGGATTGGGGGGTCTGAGGTGTAAGGCAGAGGCC

ATGGACAGGAGTCATCTTCTAGCTTTTTAAAAGCCTTGTTGCATAGAGAGGGTCTTATCGCTGGGCTGGCCCTGAGGGGAATAGACCAGCGCCCACAGAA

GAGCATAGCACTGGCCCTAGAGCTGGCTCTGTACTAGGAGACAATTGCACTAAATGAGTCCTATTCCCAAAGAACTGCTGCCCTTCCCAACCGAGCCCTG

GGATGGTTCCCAAGCCAGTGAAATGTGAAGGGAAAAAAAATGGGGTCCTGTGAAGGTTGGCTCCCTTAGCCTCAGAGGGAATCTGCCTCACTACCTGCTC

CAGCTGTGGGGCTCAGGAAAAAAAAATGGCACTTTCTCTGTGGACTTTGCCACATTTCTGATCAGAGGTGTACACTAACATTTCTCCCCAGTCTAGGCCT

TTGCATTTATTTATATAGTGCCTTGCCTGGTGCCTGCTGTCTCCTCAGGCCTTGGCAGTCCTCAGCAGGCCCAGGGAAAAGGGGGGTTGTGAGCGCCTTG

GCGTGACTCTTGACTATCTATTAGAAACGCCACCTAACTGCTAAATGGTGTTTGGTCATGTGGTGGACCTGTGTAAATATGTATATTTGTCTTTTTATAA

AAATTTAAGTTGTTT
Translation
 - UNI24239 - MPITRMRMRPWLEMQINSNQIPGLIWINK - UNI24239 - EEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTG - UNI242

78 - GRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTRNQRKE ERKSKSSRDTKSKTKRK LCGDVSPDTFSDGLSS

STLPDDHSSYTTQGYLGQDLDMERDITPA ALSPCVVSSSLSEWHMQMDIIPDSTTDLYNLQVSPMPSTSEA AATDEDEEGKIAEDLMK LFEQSEWQP

THIDGKGYLLNEPGTQLSSVYGDFSCKEEPEIDSPRG GDIGIGIQHVFTEMKNMDSIMWMDSLLGNSVRLPPSIQAIPCAP
Transcript ENSMUST00000108920
Sequence
GGACGTGCTTTCACAGTCTAAGCCGAACCGAACCGAACCGAACCGAACCGAACCGGGCCGAGTTGCGCCGAGGTCAGCCGAGGTGGCCAGAGGGACCCCA

GCATCTCGGGCATCTTTCGCTTCGTGCGCGCATCGCGTACCTACACCGCAACTCCGTGCCTCGCTCTCCGGCACCCTCTGCGAATCGCTCCTGCAGCAAA

G - UNI24239 - CCACCATGCCAATCACTCGAATGCGGATGAGACCCTGGCTAGAGATGCAGATTAATTCCAACCAAATCCCAGGGCTGATCTGGAT

CAATAAA - UNI24239 - GAAGAGATGATCTTCCAGATTCCATGGAAGCACGCTGCTAAGCACGGCTGGGACATCAACAAGGATGCCTGTCTGTTCC

GGAGCTGGGCCATTCACACAG - UNI24278 - GCCGATACAAAGCAGGAGAAAAAGAGCCAGATCCCAAGACATGGAAGGCAAACTTCCGTTGTGCC

ATGAACTCCCTGCCAGACATCGAGGAAGTGAAGGATCAGAGTAGGAACAAGGGCAGCTCTGCTGTGCGGGTGTACCGGATGCTGCCACCCCTCACCAGGA

ACCAGAGGAAAG AGAGAAAGTCCAAGTCCAGCCGAGACACTAAGAGCAAAACCAAGAGGAAG CTGTGTGGAGATGTTAGCCCGGACACTTTCTCTGAT

GGACTCAGCAGCTCTACCCTACCTGATGACCACAGCAGTTACACCACTCAGGGCTACCTGGGTCAGGACTTGGATATGGAAAGGGACATAACTCCAG CA

CTGTCACCGTGTGTCGTCAGCAGCAGTCTCTCTGAGTGGCATATGCAGATGGACATTATACCAGATAGCACCACTGATCTGTATAACCTACAGGTGTCAC

CCATGCCTTCCACCTCCGAAG CCGCAACAGACGAGGATGAGGAAGGGAAGATAGCCGAAGACCTTATGAAG CTCTTTGAACAGTCTGAGTGGCAGCCG

ACACACATCGATGGCAAGGGATACTTGCTCAATGAGCCAGGGACCCAGCTCTCTTCTGTCTATGGAGACTTCAGCTGCAAAGAGGAACCAGAGATTGACA

GCCCTCGAG GGGACATTGGGATAGGCATACAACATGTCTTCACGGAGATGAAGAATATGGACTCCATCATGTGGATGGACAGCCTGCTGGGCAACTCTG

TGAGGCTGCCGCCCTCTATTCAGGCCATTCCTTGTGCACCATAGTTTGGGTCTCTGACCCGTTCTTGCCCTCCTGAGTGAGTTAGGCCTTGGCATCATGG

TGGCTGTGATACAAAAAAAGCTAGACTCCTGTGGGCCCCTTGACACATGGCAAAGCATAGTCCCACTGCAAACAGGGGACCATCCTCCTTGGGTCAGTGG

GCTCTCAGGGCTTAGGAGGCAGAGTCTGAGTTTTCTTGTGAGGTGAAGCTGGCCCTGACTCCTAGGAAGATGGATTGGGGGGTCTGAGGTGTAAGGCAGA

GGCCATGGACAGGAGTCATCTTCTAGCTTTTTAAAAGCCTTGTTGCATAGAGAGGGTCTTATCGCTGGGCTGGCCCTGAGGGGAATAGACCAGCGCCCAC

AGAAGAGCATAGCACTGGCCCTAGAGCTGGCTCTGTACTAGGAGACAATTGCACTAAATGAGTCCTATTCCCAAAGAACTGCTGCCCTTCCCAACCGAGC

CCTGGGATGGTTCCCAAGCCAGTGAAATGTGAAGGGAAAAAAAATGGGGTCCTGTGAAGGTTGGCTCCCTTAGCCTCAGAGGGAATCTGCCTCACTACCT

GCTCCAGCTGTGGGGCTCAGGAAAAAAAAATGGCACTTTCTCTGTGGACTTTGCCACATTTCTGATCAGAGGTGTACACTAACATTTCTCCCCAGTCTAG

GCCTTTGCATTTATTTATATAGTGCCTTGCCTGGTGCCTGCTGTCTCCTCAGGCCTTGGCAGTCCTCAGCAGGCCCAGGGAAAAGGGGGGTTGTGAGCGC

CTTGGCGTGACTCTTGACTATCTATTAGAAACGCCACCTAACTGCTAAATGGTGTTTGGTCATGTGGTGGACCTGTGTAAATATGTATATTTGTCTTTTT

ATAAAAATTTAAGTTGTTTAC
Translation
 - UNI24239 - MPITRMRMRPWLEMQINSNQIPGLIWINK - UNI24239 - EEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTG - UNI242

78 - GRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTRNQRKE ERKSKSSRDTKSKTKRK LCGDVSPDTFSDGLSS

STLPDDHSSYTTQGYLGQDLDMERDITPA ALSPCVVSSSLSEWHMQMDIIPDSTTDLYNLQVSPMPSTSEA AATDEDEEGKIAEDLMK LFEQSEWQP

THIDGKGYLLNEPGTQLSSVYGDFSCKEEPEIDSPRG GDIGIGIQHVFTEMKNMDSIMWMDSLLGNSVRLPPSIQAIPCAP
Transcript ENSMUST00000108922
Sequence
AGTGCGCACCACTCCTTCGTCGAGGTAGGACGTGCTTTCACAGTCTAAGCCGAACCGAACCGAACCGAACCGAACCGAACCGGGCCGAGTTGCGCCGAGG

TCAGCCGAGGTGGCCAGAGGGACCCCAGCATCTCGGGCATCTTTCGCTTCGTGCGCGCATCGCGTACCTACACCGCAACTCCGTGCCTCGCTCTCCGGCA

CCCTCTGCGAATCGCTCCTGCAGCAAAG - UNI24239 - CCACCATGCCAATCACTCGAATGCGGATGAGACCCTGGCTAGAGATGCAGATTAATTC

CAACCAAATCCCAGGGCTGATCTGGATCAATAAA - UNI24239 - GAAGAGATGATCTTCCAGATTCCATGGAAGCACGCTGCTAAGCACGGCTGGG

ACATCAACAAGGATGCCTGTCTGTTCCGGAGCTGGGCCATTCACACAG - UNI24278 - GCCGATACAAAGCAGGAGAAAAAGAGCCAGATCCCAAG

ACATGGAAGGCAAACTTCCGTTGTGCCATGAACTCCCTGCCAGACATCGAGGAAGTGAAGGATCAGAGTAGGAACAAGGGCAGCTCTGCTGTGCGGGTGT

ACCGGATGCTGCCACCCCTCACCAGGAACCAGAGGAAAG AGAGAAAGTCCAAGTCCAGCCGAGACACTAAGAGCAAAACCAAGAGGAAG CTGTGTGGA

GATGTTAGCCCGGACACTTTCTCTGATGGACTCAGCAGCTCTACCCTACCTGATGACCACAGCAGTTACACCACTCAGGGCTACCTGGGTCAGGACTTGG

ATATGGAAAGGGACATAACTCCAG CACTGTCACCGTGTGTCGTCAGCAGCAGTCTCTCTGAGTGGCATATGCAGATGGACATTATACCAGATAGCACCA

CTGATCTGTATAACCTACAGGTGTCACCCATGCCTTCCACCTCCGAAG CCGCAACAGACGAGGATGAGGAAGGGAAGATAGCCGAAGACCTTATGAAG 

CTCTTTGAACAGTCTGAGTGGCAGCCGACACACATCGATGGCAAGGGATACTTGCTCAATGAGCCAGGGACCCAGCTCTCTTCTGTCTATGGAGACTTCA

GCTGCAAAGAGGAACCAGAGATTGACAGCCCTCGAG GAAACCTCCTGATGGGAGTCTTTTGCTGGCTTTCTGCCTGGGCTTCAGCTGAGCATTGACATG

CGTCGATCACGAATCTTTCCAGTTATGGTCAAGAAGAAGATGGCAGGAGGAGGGGGCGTCATGCCACAGGGACATGCTCATTTATACTCATTTGCCACGG

AAGGGAGTTTTTATTTTAATTTTTCACTTCATGTGCCTGAATGTATGTCTATGTAAGGGTGTCAGATCCTCTGGAAATTGAGTCACAGACAGCTGTAAGC

TGCCATGTGGTGCTGAAAATTGAATTTGGATCCTCAGGGAGAGCAGCCAGTGTGCTCTTCACTGCTGAGCCATCTCTCCGGCTGGGTTTTTGGTTTTGTT

GTTTGTTTGTTTTTGAGACAGCGCCCCACAGTGTATCCGTGGCTTTCCTGGAACTCACTGTGTAGACCAGGCTGGCCTCAAACTCAAAGAGCTCTGCCTG

CCTCTGAGTTTGTATGTGTAGGTCAGAGGTCAACAACTCCTAGAGGTTGGTTCTTTAACTTTGTAGGTCTTCCGGCCGGCTTGGGAGTTGATTTTGAACT

CTTGGGGCCCAGTTGTCTGTCAGCCTGTGACACATTCAGCCTGTTGGTTCTGTTGAGCAAACAGGAACCATTTCAAACAACAGACAATTGGTGTGACACT

GACCATTTAGACAACAGTGCAGGCAATGTCCCCAGGGCCTGCTGTGCTGCTGGTCTTGCTGGGTACTGACACTCGTCAAGCCTGAGAACTGAGTAGCTGA

AAATGTGTCCAGAGATACATTCAGGAACTTGATGTTTAATTTCAAGAAAAGTTTGAATCGCCCCAGGTGACTGTGGTTTGGACTCACCTGGAAACGGTTT

GGGGCTGAATGACTGAAGGACAGGACGGAATGAAGGACTGATTGCTGGCTAGTTCACGCCTACCTGCTTATTTTAGATGTTAATTCTGAGCGCTGAATAC

CAACCCCACAGCATACATTATACATGCACATAGGACGATC
Translation
 - UNI24239 - MPITRMRMRPWLEMQINSNQIPGLIWINK - UNI24239 - EEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTG - UNI242

78 - GRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTRNQRKE ERKSKSSRDTKSKTKRK LCGDVSPDTFSDGLSS

STLPDDHSSYTTQGYLGQDLDMERDITPA ALSPCVVSSSLSEWHMQMDIIPDSTTDLYNLQVSPMPSTSEA AATDEDEEGKIAEDLMK LFEQSEWQP

THIDGKGYLLNEPGTQLSSVYGDFSCKEEPEIDSPRG GNLLMGVFCWLSAWASAEH

For any suggestions or comments, please send an email to unitrap@crg.es