Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000018965 (Ywhah)
Chromosomal location
Chr 5: 33361604 - 33370609 (+)
Description
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide Gene [Source:MGI (curated);Acc:Ywhah-001]
RefSeq_dna
NM_011738 
RefSeq_peptide
NP_035868.1 
UniGene
Mm.354610 
MGI
MGI:109194 
Uniprot/SWISSPROT
P68510 
Human Ortholog
ENSG00000128245 (YWHAH)
Omim not available
UniTrap UNI641
Vector Insertion
Chr 5: 33361804 - 33369190
Public Clones AX0660 (sanger) DD0501 (sanger) (sanger) E080H04 (ggtc) P116D10 (ggtc)
P127C03 (ggtc) CMHD-GT_97H6-3 (cmhd) CMHD-GT_98B4-3 (cmhd) CMHD-GT_98B8-3 (cmhd)
CMHD-GT_269C5-3 (cmhd) CMHD-GT_359H2-3 (cmhd) CMHD-GT_172G12-3 (cmhd) FHCRC-GT-S13-10C1 (fhcrc)
IST12850D10 (tigm) IST12218E12 (tigm) IST14889G6 (tigm) IST10984D10 (tigm)
Private Clones OST412859 (lexicon) OST273840 (lexicon) OST178994 (lexicon) OST158299 (lexicon)
OST128517 (lexicon) OST128401 (lexicon) OST128385 (lexicon) OST33864 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000019109
Sequence
GCGCGTGCGCGGTAGCGGCCTCGGCGGCGACCGGGAAGCGGACGGGCGGGCGAGCGAGCGAGCGAGTGAGCAGGCGGTGTGGGCGTGCGAGGCGAGGCCG

AGTCGCGAGCGACATGGGGGATCGAGAGCAGCTGCTGCAGCGGGCGCGACTGGCGGAGCAGGCGGAGCGCTACGACGATATGGCCTCCGCCATGAAGGCG

 - UNI641 - GTGACAGAGCTGAATGAACCACTATCTAACGAAGATCGAAATCTCCTCTCTGTGGCCTACAAGAATGTAGTTGGTGCCAGGCGATCTT

CTTGGAGGGTTATTAGTAGCATTGAGCAGAAAACCATGGCAGATGGGAATGAGAAGAAGTTGGAGAAAGTTAAAGCCTACCGGGAGAAGATTGAAAAGGA

GCTGGAGACAGTTTGCAATGATGTCTTGGCTCTGCTTGACAAGTTCCTTATCAAGAACTGCAATGATTTTCAGTATGAGAGCAAGGTGTTCTACCTGAAA

ATGAAGGGCGATTACTACCGCTACCTGGCAGAGGTGGCTTCTGGGGAGAAGAAAAACAGTGTGGTTGAAGCTTCTGAGGCCGCGTATAAGGAAGCCTTCG

AAATCAGCAAAGAGCACATGCAGCCAACACACCCCATCCGGCTTGGCCTGGCCCTCAATTTTTCTGTGTTCTACTATGAGATCCAGAATGCACCAGAGCA

AGCCTGCCTCTTAGCCAAACAAGCCTTCGATGATGCTATAGCTGAGCTGGACACATTAAACGAGGATTCCTATAAGGACTCCACTCTCATCATGCAGTTG

CTGCGAGACAACCTCACCCTCTGGACGAGCGACCAGCAGGATGAAGAAGCAGGAGAAGGCAACTGAAGACCCTTCAGGTCCCTGGCTCTTCCTTCACCCA

CCACCCCCATTATCACTGATTCTTCCTTGCCACAATCACTATATCTAGTGCTAAACCTATCTGTATTGGCAGCACAGCTATTCAGATCTGCCCTCCTGTC

CCTTGGGAAGCAGTTTCAGATAAACCTTCATGGGCATTTGCTGGACTGATGGTTGCTTTGAGTCACAGGGCGCTTCCTTTTTGAATTGTGCAGAGAAGTG

TGTTCTGAACAAGGCATTTTATTATGTCTGTTGATCTCTAGCAAATCCAGGTGATGGTAATTGAGTGTAGAAAGGAGAATTAGCCAACACAGGCTATGGC

TGCTATTTAAAACAAGCTGATAGTGTTTTGTTAAGCAGTACATCTTGTGCATGCAAAAATGAATTTGACCCTCTCACCCCTCCCTTCAGCTAATGGAAAC

TGACACAGCGACAACTCATTCCTTCACCATCAGCTTTATAAACTGTTTCTTGTGAGCTTTCAGCAGCCCTTGCTGTGCCTCTTTAAATTATGATGTGCAC

ACACCTTCCTTTCAATGCAATGCATCAGAAGTTTTTGATATGTGTAACTTTTTTTTGATTGTGATTAAGAATCATGGATTTATTTTTTGTAACTCTTTGG

CTATTGTTCTTGTGTACCCTGACAGCATCATGTGTGTCAACCTGTGTCAATTATGATGGGTGGTTATGAAATGCCAGACTGCTAAAATAAATGTTTTGGA

CTTAAAAGAGTAAATAAATGCTGCTTTAGGG
Translation
MGDREQLLQRARLAEQAERYDDMASAMKA - UNI641 - VTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREK

IEKELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQN

APEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

For any suggestions or comments, please send an email to unitrap@crg.es