Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019039 (Dalrd3)
Chromosomal location
Chr 9: 108472242 - 108475103 (+)
Description
DALR anticodon binding domain containing 3 Gene [Source:MGI Symbol;Acc:MGI:1915039]
RefSeq_dna
NM_026378 
RefSeq_peptide
NP_080654.3 
UniGene
Mm.458081 
MGI
MGI:1915039 
Uniprot/SWISSPROT
Q6PJN8 
Human Ortholog
ENSG00000178149 (DALRD3)
Omim not available
UniTrap UNI24535
Vector Insertion
Chr 9: 108472777 - 108472894
Public Clones not available
Private Clones OST216225 (lexicon)
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000019183
Sequence
ATGGCGACCGGGCGCCTTGGGGTTGGCGAGACGCTGGAGGCCCTTAATGCAGCTGTAGGGCCTGGTAGCCCAGTGTGGTTTAAGGAAACCCATGCCCGGC

ACCTTCGTGTTCGAGACTTCTTGGCACCGCGAAGCGCGCTACAGGCGCGCTTCAGGGACGGCCAG GTGCCAGAGTGCGTGTTCCGTGCGGTCTCCTGCC

TGCAGGGTCCCGGAGTGGCCCCTGTACTGCGCTGCGCGCCGACACCCGCGGGTTTATCGCTCCAACTACAGCGGCCCGCTGTCTTCGAACATGTACTCGG

TGCCCTGGCCTCCTATGCTACTCCCGCCAAACCTGCCTCACCAGGCCCGCGAGTTGTCCTACACTGCCCAGCACTGCGCTGTAATTCGGGGACGCTCCGA

TTGAGCCAGCTGCGTGCCGTGCTCGTAGCCGATCATCTAGTACGGGTACTGCGTGCTCATGG - UNI24535 - GGTACGTGTGTGCTCAGTGCCCCC

GGTGCGGGACCCTCACATGTCAACTTTCCTCCAGAAACTTCGGGTGGAATGGCCCACTGCCTCGAAGAGCACCTCGACCGAAACACTGAGAACCTGTGTT

CTTGCAAACCTTAATGGTTCTAAGGAAGCGACGCTGCCCCCTGGCGTCCTAGGCCGACTGTGTCTGAAGGAACTGGTAGAACAGAGAGGCACTGCTGGCT

ATGACCCCAGCATAGACCACTGTTTGG TGACTGAAGATGTGCTCTCTGTGCTCTCGGAGCTGCAGGAGGCTGTGCGCCACTGGCCAGAGGGCGGCCACC

CAGGCCCG GCTGGGCGTCCAGATGCTGGTGTAGATGACTGCGTGGTTATACACGTGGTTAGCTGTGAAGAGGCATTCCAGCAACAAAAGCTGGATTTGC

TCTGGCAGAAATTGGATGACCGGGCTCCTCACAAGCAG AAACACCTGGTGTGTGGTCCCGTGAAAATGGCTGGTGTACCCGGCACCCAGCTGACTGCCC

CTCAGTACTACAG GCTCAGACATGCTCAGGTGTGCGAGGCCTCAGCTCTGAAGCACGGAGGAGACCTGGCACAAG ACCCCGCCTGGACTGAGACCTTC

GACATCCTCTCCGTGGCTACCATCAAATTTGAGATGCTAAGCACAGCCCCACAGAGCCAG CTCCTCCTGGCCCACAGCACCATCTCAACAAAGGGCACA

AAGAGCGGGACTTTTGTCATGTATAACTGTGCCCGCCTTGCCACACTCTTCGAGGGCTACAAACATGGAACGGAGCAAGGTCTGTATCCCACTTTTCCGC

TTGTGAGCAGTCTGGACTTCTCACTACTCCATGATGAG GGTGAGTGGCTGCTGCTTTTCAACAGTGTCCTTCCCTTTCTGGACCTGCTGAGCCAGACTG

TGAGTCTGGCCGGCACCCCAGGCCTCCACATCCCTGTCCGCACGGAGATG GTATGCAAGTTCCTGGTGCAGCTCAGCATGGATTTCAGCTCCTACTATA

ACCGAGTACATATTCTAGGG GAACCTCGGCCACACCTCTTTGGTCAGATGTTTGCTCGCCTACAGCTTTTGAGGGCAGTGCGTGAGGTGTTCCACACAG

GCTTGGCTATGCTGGGCCTCCCTCCGCTGAGCCACATCTAAGGGCCCAATAACTGGGAATGTTTATAAAAGCATCAACTGGGAAAGAAACAAGACCTCAC

AGATGTTGGGCACTTAAAGTCAGAATAAATACAGTTTCATCCT
Translation
MATGRLGVGETLEALNAAVGPGSPVWFKETHARHLRVRDFLAPRSALQARFRDGQ VPECVFRAVSCLQGPGVAPVLRCAPTPAGLSLQLQRPAVFEHVL

GALASYATPAKPASPGPRVVLHCPALRCNSGTLRLSQLRAVLVADHLVRVLRAHG - UNI24535 - GVRVCSVPPVRDPHMSTFLQKLRVEWPTASK

STSTETLRTCVLANLNGSKEATLPPGVLGRLCLKELVEQRGTAGYDPSIDHCLV VTEDVLSVLSELQEAVRHWPEGGHPGP AGRPDAGVDDCVVIHVV

SCEEAFQQQKLDLLWQKLDDRAPHKQ KHLVCGPVKMAGVPGTQLTAPQYYR RLRHAQVCEASALKHGGDLAQD DPAWTETFDILSVATIKFEMLSTA

PQSQ LLLAHSTISTKGTKSGTFVMYNCARLATLFEGYKHGTEQGLYPTFPLVSSLDFSLLHDE GEWLLLFNSVLPFLDLLSQTVSLAGTPGLHIPVRT

EM VCKFLVQLSMDFSSYYNRVHILG EPRPHLFGQMFARLQLLRAVREVFHTGLAMLGLPPLSHI

For any suggestions or comments, please send an email to unitrap@crg.es