Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019054 (Fis1)
Chromosomal location
Chr 5: 137429145 - 137442102 (+)
Description
Friend virus integration site 1 Gene [Source:MGI (curated);Acc:Fis1-002]
RefSeq_dna
NM_025562 
RefSeq_peptide
NP_079838.1 
UniGene
Mm.415628 
MGI
MGI:1913687 
Uniprot/SWISSPROT
Q9CQ92 
Human Ortholog
ENSG00000214253 (FIS1)
Omim not available
UniTrap UNI6498
Vector Insertion
Chr 5: 137429461 - 137437975
Public Clones YHC342 (baygenomics) XH850 (baygenomics) FHCRC-GT-S17-9G2 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33931
Vector Insertion
Chr 5: 137429461 - 137437975
Public Clones (sanger) IST15011B11 (tigm) IST10033G10 (tigm) IST13076C9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14502
Vector Insertion
Chr 5: 137438099 - 137438868
Public Clones D124E03 (ggtc) FHCRC-GT-S9-7D1 (fhcrc) IST14635B8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16986
Vector Insertion
Chr 5: 137439002 - 137440962
Public Clones not available
Private Clones OST451327 (lexicon) OST350452 (lexicon) OST262927 (lexicon) OST173224 (lexicon)
OST142631 (lexicon) OST127305 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16987
Vector Insertion
Chr 5: 137441040 - 137441434
Public Clones not available
Private Clones OST451325 (lexicon)
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111097
Sequence
TTGCGTGTTAAGGGATGAACCCCCAAAGTGCCTGTAGAAAACAGCTCTGGGCCTAATGTCCTGGCTGCGGTGCAGGATGAAAGACTCCGGTTGATAGACC

GCTACGGAGAAAAACCAAAGAAGGCTGTCATGAGAACATCCTCGGGTGCAGGGGTCCATGGATGCCCAGAGACGAAGCTGCAAGG - UNI6498 - - 

UNI14502 - - UNI16986 - - UNI33931 - AGCTGTTGCCCAAAGGGAGCAAAGAGGAACAGCGGGACTATGTCTTCTACCTGGCCGTGGGCA

ACTACCGGCTCAAG - UNI16987 - GAATATGAAAAGGCTCTAAAGTATGTGCGAGGGCTGTTGCAGACTGAGCCCCAGAACAACCAGGCCAAGGAG

CTGGAACGCCTGATTGATAAGGCCATGAAGAAAG ATGGACTGGTAGGCATGGCCATCGTTGGTGGCATGGCCCTGGGCGTGGCAGGCCTGGCTGGACTC

ATTGGACTGGCTGTCTCCAAGTCCAAATCCTGAAGGCAGCCTCACCTGCTCTCTGCCCCGGGACGCCTAGGAGCCTGGGGGACACTGGAAGAGGGGCCTG

TCCATCCTCACCATCGCCTTCCCTTTTCTCCTGCACCCCTGTAGTCTACCTCTACAGTCTCCATGACC
Translation
MDAQRRSCKE - UNI6498 - - UNI14502 - - UNI16986 - - UNI33931 - ELLPKGSKEEQRDYVFYLAVGNYRLK - UNI16987 

- EYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD DGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
Transcript ENSMUST00000111094
Sequence
CAGAGGGACCCTAGCGTGCTTTCTGTAACGCCTGCCGTTACTCCTTCTACCCCGAGGCTGTCCTAAGAGGGCTCTCCTTTGTCAGAAAAGATGAATGAAG

CATAGTAGCTGTAGCATGAAGGGTTACAGTGTTGCGTGTTAAGGGATGAACCCCCAAAGTGCCTGTAGAAAACAGCTCTGGGCCTAATGTCCTGGCTGCG

GTGCAGGATGAAAGACTCCGGTTGATAGACCGCTACGGAGAAAAACCAAAGAAGGCTGTCATGAGAACATCCTCGGGTGCAGGGGTCCATGGATGCCCAG

AGACGAAGCTGCAAGG - UNI6498 - - UNI14502 - - UNI33931 - AATTTTGAAAGGAAATTTCAGTCTGAGCAGGCAGCTGGTTCTGTG

TCCAAGAGCACGCAATTTGAATATGCCTGGTGCCTGGTTCGAAGCAAATACAATGAGGACATCCGCAGAGGCATCGTGCTGCTGGAGG - UNI16986 

- AGCTGTTGCCCAAAGGGAGCAAAGAGGAACAGCGGGACTATGTCTTCTACCTGGCCGTGGGCAACTACCGGCTCAAG - UNI16987 - GAATATG

AAAAGGCTCTAAAGTATGTGCGAGGGCTGTTGCAGACTGAGCCCCAGAACAACCAGGCCAAGGAGCTGGAACGCCTGATTGATAAGGCCATGAAGAAAG 

ATGGACTGGTAGGCATGGCCATCGTTGGTGGCATGGCCCTGGGCGTGGCAGGCCTGGCTGGACTCATTGGACTGGCTGTCTCCAAGTCCAAATCCTGAAG

GCAGCCTCACCTGCTCTCTGCCCCGGGACGCCTAGGAGCCTGGGGGACACTGGAAGAGGGGCCTGTCCATCCTCACCATCGCCTTCCCTTTTCTCCTGCA

CCCCTGTAGTCTACCTCTACAGTCTCCATGACCCCCAGCCTCTTAGCCCCTGCACCTGTCGTTTAACCCTGTCATGCTTTGCAATGAGTGTAAATAAAAT

TGGGCCGTGGCTCGGG
Translation
MPRDEAAR - UNI6498 - - UNI14502 - - UNI33931 - NFERKFQSEQAAGSVSKSTQFEYAWCLVRSKYNEDIRRGIVLLEE - UNI16

986 - ELLPKGSKEEQRDYVFYLAVGNYRLK - UNI16987 - EYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD DGLVGMAIVGGMALGVA

GLAGLIGLAVSKSKS
Transcript ENSMUST00000019198
Sequence
CTCTCCGCCCCTGCTACTGGACCATGGAGACTGTGGCCCAGTAGAGACCTTAGTGTGAGGCTTTCAGGGGCGGCGGCCATGGAGGCCGTGCTGAACGAGC

TGGTGTCTGTGGAGGATCTGAAG - UNI14502 - AATTTTGAAAGGAAATTTCAGTCTGAGCAGGCAGCTGGTTCTGTGTCCAAGAGCACGCAATTT

GAATATGCCTGGTGCCTGGTTCGAAGCAAATACAATGAGGACATCCGCAGAGGCATCGTGCTGCTGGAGG - UNI16986 - AGCTGTTGCCCAAAGG

GAGCAAAGAGGAACAGCGGGACTATGTCTTCTACCTGGCCGTGGGCAACTACCGGCTCAAG - UNI16987 - GAATATGAAAAGGCTCTAAAGTATG

TGCGAGGGCTGTTGCAGACTGAGCCCCAGAACAACCAGGCCAAGGAGCTGGAACGCCTGATTGATAAGGCCATGAAGAAAG ATGGACTGGTAGGCATGG

CCATCGTTGGTGGCATGGCCCTGGGCGTGGCAGGCCTGGCTGGACTCATTGGACTGGCTGTCTCCAAGTCCAAATCCTGAAGGCAGCCTCACCTGCTCTC

TGCCCCGGGACGCCTAGGAGCCTGGGGGACACTGGAAGAGGGGCCTGTCCATCCTCACCATCGCCTTCCCTTTTCTCCTGCACCCCTGTAGTCTACCTCT

ACAGTCTCCATGACCCCCAGCCTCTTAGCCCCTGCACCTGTCGTTTAACCCTGTCATGCTTTGCAATGAGTGTAAATAAAATTGGGCCGTGGCTCGGG
Translation
MEAVLNELVSVEDLK - UNI14502 - NFERKFQSEQAAGSVSKSTQFEYAWCLVRSKYNEDIRRGIVLLEE - UNI16986 - ELLPKGSKEEQR

DYVFYLAVGNYRLK - UNI16987 - EYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD DGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS

For any suggestions or comments, please send an email to unitrap@crg.es