Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019066 (Rab3d)
Chromosomal location
Chr 9: 21711954 - 21722583 (-)
Description
RAB3D, member RAS oncogene family Gene [Source:MGI (curated);Acc:Rab3d-002]
RefSeq_dna
NM_031874 
RefSeq_peptide
NP_114080.2 
UniGene
Mm.260157 
MGI
MGI:97844 
Uniprot/SWISSPROT
P35276 
Uniprot/SPTREMBL
Q543Q4 Q8BP17 
Human Ortholog
ENSG00000105514 (RAB3D)
Omim not available
UniTrap UNI17211
Vector Insertion
Chr 9: 21720148 - 21720388
Public Clones not available
Private Clones OST447527 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000122211
Sequence
GCGCGGGATCCGGGTGTCAGTGTTGGCAGCGCCGGCAGCTGTGGGGCGAGGGTCGCAGCCCTGTGCGGGGCCGTAGCAACTTCGTGGGCGGATCCTGGTG

TGCAAGGCGGGACCCGAG ATCCACGTGTCGGAAGATGTGATTCTTGAAACCAATGGACCCATAGACTCACCCTTACGGAAGCTGCCCTCTTACAGGAGT

CCCCTCTTTGACATCAGGATTTCTGGTCTCCCCTCCAAGCAGATCCCACTGAGATGGCATCCGCTAGTGAGCCCCCTGCCAGCCCAAGAGACGCTGCTGA

CCAGAACTTTGACTACATGTTCAAACTGCTCTTGATCGGGAACAGCAGCGTGGGCAAGACATCCTTCCTGTTCCGCTATGCCGATGACTCCTTCACCCCT

GCCTTCGTGAGCACAGTGGGCATCGACTTCAAGGTCAAGACGGTCTACCGACATGACAAGAGGATCAAGCTGCAGATTTGG - UNI17211 - GACAC

AGCAGGCCAGGAGCGCTACCGGACAATCACCACGGCCTACTATCGCGGAGCTATGGGTTTCCTGCTCATGTATGACATCGCCAACCAGGAGTCCTTCACC

GCGGTGCAGGACTG GGCTACGCAGATCAAAACCTATTCCTGGGACAATGCCCAGGTAATCCTCGTGGGGAACAAGTGTGACCTGGAAGACGAACGGGTC

GTACCTGCTGAGGATGGCCGGAGGCTCGCCGATGATCTTG GTTTTGAGTTCTTTGAGGCCAGCGCCAAGGAGAATATCAATGTGAAGCAGGTGTTCGAG

CGCCTGGTGGACATCATCTGTGACAAGATGAATGAATCCCTGGAACCCAGCTCCAGCCCAGGCAGCAATGGAAAAGGCCCAGCCCTTGGGGATACCCCAC

CCCCACAGCCGAGCAGCTGCAGCTGTTAGGTTCAGCCCCTTACCTCCCCACACCTGTCCCTTCTTGCCTCTTCAAGGACAGCAGCTAAGGTGTGAGCTAT

GGGGACTGTCTCTCAGCTCAGGGCACCCTTGCCTCTGGGCCACTTCCCACTCCTCTTGCACAAGTTCATGTCCCTTTCTCTCCATGTCAGAATGCTCAGA

CACTCCTGGTTAGAGCCCACACACCCCGGGCTCTGCTCAGCATTGTCTGAGGGGTTGGGGTACCCACACAGGTGCTTGCTGCTTCCCACGGCATTTTGAT

GGAGGTAGCTGTGGCGGCATTGCCTTCCCTGAGTGAGAGAGGGGATGTTCATGCCTTCTGCCTTAGAACCATTTCCCAGGTCTACTCTTCATATCGCTGG

CTGAAGTTGTCACCTGGCGTGGGTTGCTGTCCAACTTAGTCCTGGCAGCCTCTCTATCTCAGGTCCACCAGTTTGGCCTTGAAACCTGCCTGTGAACTGA

CTGCTAGCCAAGGACACAGGCAGGGCTGCAGTCTCCATCCTCTGCCTCCCTGGCGTCTACCGGAAGGGAAAACCTGTTTTCTGGTTAAAGAAGGGACAGA

GTTGGAGCTACCCCTGGCACCGGGAACTCTCCAAAGTGCCTTCCCAGCTTCCCCTGAGTCTATCCACTCAGTGTGGGTTAATCTACTCCCAGAATTAAAT

TTTGGAGTATTCCAGGGCCTGTCACATGGGGCTGAGAATCGCCCACCCTAGCAGTCCAGCTTTCTGTCAGTTCACCTCAGAGCCAGGGAACTGAGGCCGC

CTGCCCAGGCTCCCATCTGTCTGCCTGGTGGTGGCTTAGGCAAGAGCTTTACAAACCTTACATCCTGTGTAGAAACGGAAGTGGAGAAAGCAGCCCACAG

AGGGTGTGCCCTTGCTGGTCAGTTTCTTATGACAGGATTTGGGCTTCTCCACATGAGGACTCTTGTGTAGACCCAGTGTCAGCATCATGGCCGTTGCCCA

GGGACACTGGGGCTGTGGGGAAGGACTGGGGGAAGGCACTAGTGGGCAACCCAGTCCGTCATGGGAGCAGGAGTCCTTCCTGTGAATTAGGGATGGGCTG

TGGGTTGTGACTGCTTTCTCTACAAAGCTTGAGACGTAGCCCCTAGGACCCTGGGTTCTATTTCTATTCACTGACCAGACTCCCCTAAACACTATCTGAC

ATTTCATGGTCCAGGTGACAGATGCTCTGTGTCACACACCCCTGACTCTGTATGGGGGGTGGAGTGTACTCCTTCAGCCCCCACAGCCAGAATCACTTCT

GCAGCCTTCCTGAGCTCAGCACCCTCCCTGACTGTGTATGACCTACAGTGCCTGGTTCAGATGTATTTCTAGCCCTGCCAGTGGCTGTCTTTGTACAGAT

TGGACAAGCAGAGTGAAGGTGTCTAAACACTTAGAGGAAAGACTCAATTTTTTAAAATGTTGCTTTATCATTAAATAGTCAAAACGGTGCAAATTATGTT

CTTAAGATTCAGCAACCTGCAGGGCGTTGTGGTGGTGAAAATTTTTGATCCCAGCATTCTGGAGGCAGAGGCAGGTGGATCTCTGAGTTCGAGACCAGCC

TGATCTACAGAGCAAGTTCCAGGATAGCCAGGGCTACACAGAGAAACCCTGTTTTGAAAAACAGAGAGAAGGAGAGAGAGAGCAAGAGAGAATGATGCAG

CTAGTCTGGAAGGAACCTGGAACTAGCTCTCTCGCTAGCATTTGCCTACTGTTTTGCACAGGGTCCTGGCTTGAAGACCCAGCACTGCACAAACTAGGCA

CGTGCTCCAGGGATGTCATTCTAGTAGAGGCAGGAGGATCGGAAGTTTGGAGTCACCTTTGAGTACTACCTAGGAAGTTTGAGGCTAGCCTGGAGCTATA

AGAGGCTGACACGGGGCGGGGGTGGGAGGAAGGCCTGTCAAAGACTCTATGGACCAGTCCATTCCCAAGCAGAGTCGTGGAGATCCTGCCCGTAGTTAGC

TAAGACCGGTCCTGACGTTTTGTGTCAACTAAATCGCGTCTGACTGTATCTTGGACTTAGTCTCGGCTTCCTGTTGCTAGAAGAGGCTCCTTCACTTCTA

CTCTGAACACCCACAGAGGAAGCCACCCTGTGGTTTTCTTACAACTGGGGATTTGGCTGGTGGAATGGCTCATCTGAAGACACTGCCACCAAGCCTGATG

ACCTGAGTTAGACCTCGGGATCCATGAGGTAGAAGAAGAGAAATGAGCCCTTTAAGCCACCATCTCCCCTCCACGGTGAGCAAGGGTGTGTGCACAGTCA

GTGTCAGACAAAAAAAAAAAAAAAATAACCCTACTGTGGAAACTGAATAATGTGGAAACCTCCTTGTTTCTTCCTCCCATGAAAGGTGATTTGAACCTTT

TGATTCTTCCATTAGGTTTTACGGAGGATGGGTGAGGGGTCACTAAGTGAACAGGAGCTGGCCGTCTGTGCAGATGGCCGAGAGGGACGGGAGCCTGATG

GGTTTATAAACAGAAGCCATGGGCATGGGGAATGCTTCTCTGCAGGAGACTCAGGAGTAGTTAGCCTCCAGAGCTTTATCCCCCTGTCCTCCCAGGGAGG

AGTGGCCATGGCTTTGGTTTTGCTTGTTCTTATTTATGGGTCTCATGCTGTAGACCAGGCTGGTCCTGAACTCACAAAGATCCACCTGCCTGTGCCTCCT

AGTGCTGGAATTAGAGGCATACATCATTATGTCTGGCTGACGTTCTTGCCTGCTACATGGTGCAGTTATAGGTTGCACCACCATACTCTGATGCAGTGCT

AGGGATGGAGCCCAGGACTTCCTGCATGCTAGGCAAACATTCTACCAACTGGGCCTTGGCCCCGTCCTGGTCTCTGTTTCCGTGTGCTGATTCTGCTCCT

GGCTCCACGCTAGCAATTCTGAAGCAACAGTGAATCAACTCTGGTCTGGCACTGCCTATTCTCCCTGTTCTCCAGTCCAGGAAAAAATGTATAATAAAAT

AAA
Translation
 MASASEPPASPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIW - UNI17211 - DTAGQERYR

TITTAYYRGAMGFLLMYDIANQESFTAVQDW WATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLG GFEFFEASAKENINVKQVFERLVD

IICDKMNESLEPSSSPGSNGKGPALGDTPPPQPSSCSC
Transcript ENSMUST00000115351
Sequence
AGTGTTGGCAGCGCCGGCAGCTGTGGGGCGAGGGTCGCAGCCCTGTGCGGGGCCGTAGCAACTTCGTGGGCGGATCCTGGTGTGCAAGGCGGGACCCGAG

 - UNI17211 - ATCCCACTGAGATGGCATCCGCTAGTGAGCCCCCTGCCAGCCCAAGAGACGCTGCTGACCAGAACTTTGACTACATGTTCAAACTG

CTCTTGATCGGGAACAGCAGCGTGGGCAAGACATCCTTCCTGTTCCGCTATGCCGATGACTCCTTCACCCCTGCCTTCGTGAGCACAGTGGGCATCGACT

TCAAGGTCAAGACGGTCTACCGACATGACAAGAGGATCAAGCTGCAGATTTGG - UNI17211 - GACACAGCAGGCCAGGAGCGCTACCGGACAATC

ACCACGGCCTACTATCGCGGAGCTATGGGTTTCCTGCTCATGTATGACATCGCCAACCAGGAGTCCTTCACCGCGGTGCAGGACTG GGCTACGCAGATC

AAAACCTATTCCTGGGACAATGCCCAGGTAATCCTCGTGGGGAACAAGTGTGACCTGGAAGACGAACGGGTCGTACCTGCTGAGGATGGCCGGAGGCTCG

CCGATGATCTTG GTTTTGAGTTCTTTGAGGCCAGCGCCAAGGAGAATATCAATGTGAAGCAGGTGTTCGAGCGCCTGGTGGACATCATCTGTGACAAGA

TGAATGAATCCCTGGAACCCAGCTCCAGCCCAGGCAGCAATGGAAAAGGCCCAGCCCTTGGGGATACCCCACCCCCACAGCCGAGCAGCTGCAGCTGTTA

GGTTCAGCCCCTTACCTCCCCACACCTGTCCCTTCTTGCCTCTTCAAGGACAGCAGCTAAGGTGTGAGCTATGGGGACTGTCTCTCAGCTCAGGGCACCC

TTGCCTCTGGGCCACTTCCCACTCCTCTTGCACAAGTTCATGTCCCTTTCTCTCCATGTCAGAATGCTCAGACACTCCTGGTTAGAGCCCACACACCCCG

GGCTCTGCTCAGCATTGTCTGAGGGGTTGGGGTACCCACACAGGTGCTTGCTGCTTCCCACGGCATTTTGATGGAGGTAGCTGTGGCGGCATTGCCTTCC

CTGAGTGAGAGAGGGGATGTTCATGCCTTCTGCCTTAGAACCATTTCCCAGGTCTACTCTTCATATCGCTGGCTGAAGTTGTCACCTGGCGTGGGTTGCT

GTCCAACTTAGTCCTGGCAGCCTCTCTATCTCAGGTCCACCAGTTTGGCCTTGAAACCTGCCTGTGAACTGACTGCTAGCCAAGGACACAGGCAGGGCTG

CAGTCTCCATCCTCTGCCTCCCTGGCGTCTACCGGAAGGGAAAACCTGTTTTCTGGTTAAAGAAGGGACAGAGTTGGAGCTACCCCTGGCACCGGGAACT

CTCCAAAGTGCCTTCCCAGCTTCCCCTGAGTCTATCCACTCAGTGTGGGTTAATCTACTCCCAGAATTAAATTTTGGAGTATTCCAGGGCCTGTCACATG

GGGCTGAGAATCGCCCACCCTAGCAGTCCAGCTTTCTGTCAGTTCACCTCAGAGCCAGGGAACTGAGGCCGCCTGCCCAGGCTCCCATCTGTCTGCCTGG

TGGTGGCTTAGGCAAGAGCTTTACAAACCTTACATCCTGTGTAGAAACGGAAGTGGAGAAAGCAGCCCACAGAGGGTGTGCCCTTGCTGGTCAGTTTCTT

ATGACAGGATTTGGGCTTCTCCACATGAGGACTCTTGTGTAGACCCAGTGTCAGCATCATGGCCGTTGCCCAGGGACACTGGGGCTGTGGGGAAGGACTG

GGGGAAGGCACTAGTGGGCAACCCAGTCCGTCATGGGAGCAGGAGTCCTTCCTGTGAATTAGGGATGGGCTGTGGGTTGTGACTGCTTTCTCTACAAAGC

TTGAGACGTAGCCCCTAGGACCCTGGGTTCTATTTCTATTCACTGACCAGACTCCCCTAAACACTATCTGACATTTCATGGTCCAGGTGACAGATGCTCT

GTGTCACACACCCCTGACTCTGTATGGGGGGTGGAGTGTACTCCTTCAGCCCCCACAGCCAGAATCACTTCTGCAGCCTTCCTGAGCTCAGCACCCTCCC

TGACTGTGTATGACCTACAGTGCCTGGTTCAGATGTATTTCTAGCCCTGCCAGTGGCTGTCTTTGTACAGATTGGACAAGCAGAGTGAAGGTGTCTAAAC

ACTTAGAGGAAAGACTCAATTTTTTAAAATGTTGCTTTATCATTAAATAGTCAAAACGG
Translation
 - UNI17211 - MASASEPPASPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIW - UNI1721

1 - DTAGQERYRTITTAYYRGAMGFLLMYDIANQESFTAVQDW WATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLG GFEFFEASAKE

NINVKQVFERLVDIICDKMNESLEPSSSPGSNGKGPALGDTPPPQPSSCSC
Transcript ENSMUST00000119055
Sequence
TTGGCAGCGCCGGCAGCTGTGGGGCGAGGGTCGCAGCCCTGTGCGGGGCCGTAGCAACTTCGTGGGCGGATCCTGGTGTGCAAGGCGGGACCCGAG - U

NI17211 - ATCCCACTGAGATGGCATCCGCTAGTGAGCCCCCTGCCAGCCCAAGAGACGCTGCTGACCAGAACTTTGACTACATGTTCAAACTGCTCT

TGATCGGGAACAGCAGCGTGGGCAAGACATCCTTCCTGTTCCGCTATGCCGATGACTCCTTCACCCCTGCCTTCGTGAGCACAGTGGGCATCGACTTCAA

GGTCAAGACGGTCTACCGACATGACAAGAGGATCAAGCTGCAGATTTGG - UNI17211 - GACACAGCAGGCCAGGAGCGCTACCGGACAATCACCA

CGGCCTACTATCGCGGAGCTATGGGTTTCCTGCTCATGTATGACATCGCCAACCAGGAGTCCTTCACCGCGGTGCAGGACTG GGCTACACAGAGAAACC

CTGTTTTGAAAAACAGAGAGAAGGAGAGAGAGAGCAAGAGAGAATGATGCAGCTAGTCTGGAAGGAACCTGGAACTAGCTCTCTCGCTAGCATTTGCCTA

CTGTTTTGCACAGGGTCCTGGCTTGAAGACCCAGCACTGCACAAACTAGGCACGTGCTCCAGGGATGTCATTCTAGTAGAGGCAGGAGGATCGGAAGTTT

GGAGTCACCTTTGAGTACTACCT
Translation
 - UNI17211 - MASASEPPASPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIW - UNI1721

1 - DTAGQERYRTITTAYYRGAMGFLLMYDIANQESFTAVQDW WATQRNPVLKNREKERESKRE

For any suggestions or comments, please send an email to unitrap@crg.es