Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000019087 (Atp6ap1)
Chromosomal location
Chr X: 71542486 - 71550029 (+)
Description
ATPase, H+ transporting, lysosomal accessory protein 1 Gene [Source:MGI (curated);Acc:Atp6ap1-001]
RefSeq_dna
NM_018794 
RefSeq_peptide
NP_061264.1 
UniGene
Mm.475920 Mm.21961 
MGI
MGI:109629 
Uniprot/SWISSPROT
Q9R1Q9 
Uniprot/SPTREMBL
Q3TKX1 Q3THZ3 Q3TT23 Q3TWN7 Q3UCY7 Q3UWN7 Q571E2 Q8K567 
Human Ortholog
ENSG00000071553 (ATP6AP1)
Omim not available
UniTrap UNI19508
Vector Insertion
Chr X: 71542661 - 71542961
Public Clones not available
Private Clones OST389963 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6158
Vector Insertion
Chr X: 71542961 - 71543089
Public Clones CSG104 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114168
Sequence
ATGATGGCGGCAACAGTGGTATCTCGGATACGGACGGGGACAGGGCGGGCTCCAGTCATGTGGCTGTCTCTGTCGTTGGTGGCAGTGGCAGCAGCAGTGG

CCACGGAGCAGCAGGTGCCACTGGTACTGTGGTCGAGTGACCG - UNI6158 - - UNI19508 - GAATCTGTGGGCTCCTGTGGCCGACACACAT

GAGGGTCATATCACCAGCGATATGCAGCTTTCTACCTACTTAGACCCTGCCCTGGAGCTGGGTCCCCGTAATGTACTGCTGTTCCTACAGGACAAG - U

NI6158 - CTAAGCATTGAGGATTTCACAGCATACGGTGGTGTGTTTGGAAATAAGCAGGACAGTGCCTTTTCTAACCTGGAG AATGCCCTGGACTTG

GCCCCCTCCTCACTGGTGCTTCCTGCTGTGGACTGGTATGCAATCAGCACTCTGACCACCTACCTACAGGAGAAGCTTGGGGCTAGCCCCTTGCATGTGG

ATCTAGCTACCTTAAAGGAGCTGAAGCTCAATGCCAGCCTTCCTGCCCTGCTGCTCATCCGTCTGCCCTACACAGCCAG CTCCGGTCTGATGGCGCCCA

GGGAGGTCCTCACAGGTAACG ATGAGGTCATCGGACAGGTACTGAGCACACTCAAGTCTGAAGATGTCCCTTACACCGCAGCTCTTACTGCAGTCCGCC

CTTCTAGA GTGGCCCGTGATATAACCATGGTGGCTGGGGGTCTAGGTCGCCAGCTGCTTCAGACTCAGGTGGCATCTCCTGCGATCCATCCTCCTGTGA

GTTACAATGACACTGCCCCAAGGATCCTGTTTTGGGCACAAAACTTCTCTGTGGCATACAAAGACGAGTGGAAAGACTTGACCTCCCTCACCTTTGGTGT

GGAGAATCTTAACTTGACCGGCTCCTTCTGGAATGACTCCTTTGCCAT GCTTTCACTGACCTATGAGCCACTCTTTGGTGCAACAGTGACATTCAA GT

TCATTCTGGCTAGTCGCTTCTATCCAGTGTCTGCCCGATATTGGTTTGCCATGGAACGACTTGAAATCCACAGCAATGGCTCTGTTGCCCATTTCAATGT

TTCCCAAGTCACAGGACCTAGCATCTATTCTTTCCACTGTGAGTACGTCAGCAGTGTGAGCAAGAAAGGCAATCTCCTTGTGACCAACGTGCCCTCAGTC

TGGCAGATGACTCTTCATAACTTCCAG AGAATCTCAGTATGGTTTGAGCATGTAGCTGAGAGTTCCAGCCTTGTGCAGTCTCTGAAGGTATAG
Translation
 - UNI6158 - - UNI19508 -  - UNI6158 -       MERLEIHSNGSVAHFNVSQVTGPSIYSFHCEYVSSVSKKGNLLVTNVPSVWQMTL

HNFQ RISVWFEHVAESSSLVQSLKV
Transcript ENSMUST00000114171
Sequence
AGAGGCCCAGGCACTCACTGAAAGCTGAGGCTATGATGGCGGCAACAGTGGTATCTCGGATACGGACGGGGACAGGGCGGGCTCCAGTCATGTGGCTGTC

TCTGTCGTTGGTGGCAGTGGCAGCAGCAGTGGCCACGGAGCAGCAGGTGCCACTGGTACTGTGGTCGAGTGACCG - UNI6158 - - UNI19508 -

 GAATCTGTGGGCTCCTGTGGCCGACACACATGAGGGTCATATCACCAGCGATATGCAGCTTTCTACCTACTTAGACCCTGCCCTGGAGCTGGGTCCCCG

TAATGTACTGCTGTTCCTACAGGACAAG - UNI6158 - CTAAGCATTGAGGATTTCACAGCATACGGTGGTGTGTTTGGAAATAAGCAGGACAGTGC

CTTTTCTAACCTGGAG AATGCCCTGGACTTGGCCCCCTCCTCACTGGTGCTTCCTGCTGTGGACTGGTATGCAATCAGCACTCTGACCACCTACCTACA

GGAGAAGCTTGGGGCTAGCCCCTTGCATGTGGATCTAGCTACCTTAAAGGAGCTGAAGCTCAATGCCAGCCTTCCTGCCCTGCTGCTCATCCGTCTGCCC

TACACAGCCAG CTCCGGTCTGATGGCGCCCAGGGAGGTCCTCACAGGTAACG ATGAGGTCATCGGACAGGTACTGAGCACACTCAAGTCTGAAGATGT

CCCTTACACCGCAGCTCTTACTGCAGTCCGCCCTTCTAGA GTGGCCCGTGATATAACCATGGTGGCTGGGGGTCTAGGTCGCCAGCTGCTTCAGACTCA

GGTGGCATCTCCTGCGATCCATCCTCCTGTGAGTTACAATGACACTGCCCCAAGGATCCTGTTTTGGGCACAAAACTTCTCTGTGGCATACAAAGACGAG

TGGAAAGACTTGACCTCCCTCACCTTTGGTGTGGAGAATCTTAACTTGACCGGCTCCTTCTGGAATGACTCCTTTGCCAT GCTTTCACTGACCTATGAG

CCACTCTTTGGTGCAACAGTGACATTCAA GTTCATTCTGGCTAGTCGCTTCTATCCAGTGTCTGCCCGATATTGGTTTGCCATGGAACGACTTGAAATC

CACAGCAATGGCTCTGTTGCCCATTTCAATGTTTCCCAAGTCACAGGACCTAGCATCTATTCTTTCCACTGTGAGTACGTCAGCAGTGTGAGCAAGAAAG

GCAATCTCCTTGTGACCAACGTGCCCTCAGTCTGGCAGATGACTCTTCATAACTTCCAG AATCCCAGCTCTTACTGTGTGTGGAACCTTGTGGAACCAT

CTGATCCATGTCAATGTGTCTCCTAG
Translation
MMAATVVSRIRTGTGRAPVMWLSLSLVAVAAAVATEQQVPLVLWSSDR - UNI6158 - - UNI19508 - RNLWAPVADTHEGHITSDMQLSTYLD

PALELGPRNVLLFLQDK - UNI6158 - LSIEDFTAYGGVFGNKQDSAFSNLE NALDLAPSSLVLPAVDWYAISTLTTYLQEKLGASPLHVDLATLK

ELKLNASLPALLLIRLPYTAS SSGLMAPREVLTGND DEVIGQVLSTLKSEDVPYTAALTAVRPSR VARDITMVAGGLGRQLLQTQVASPAIHPPVSY

NDTAPRILFWAQNFSVAYKDEWKDLTSLTFGVENLNLTGSFWNDSFAM MLSLTYEPLFGATVTFK KFILASRFYPVSARYWFAMERLEIHSNGSVAHF

NVSQVTGPSIYSFHCEYVSSVSKKGNLLVTNVPSVWQMTLHNFQ NPSSYCVWNLVEPSDPCQCVS
Transcript ENSMUST00000019231
Sequence
AGAGGCCCAGGCACTCACTGAAAGCTGAGGCTATGATGGCGGCAACAGTGGTATCTCGGATACGGACGGGGACAGGGCGGGCTCCAGTCATGTGGCTGTC

TCTGTCGTTGGTGGCAGTGGCAGCAGCAGTGGCCACGGAGCAGCAGGTGCCACTGGTACTGTGGTCGAGTGACCG - UNI6158 - - UNI19508 -

 GAATCTGTGGGCTCCTGTGGCCGACACACATGAGGGTCATATCACCAGCGATATGCAGCTTTCTACCTACTTAGACCCTGCCCTGGAGCTGGGTCCCCG

TAATGTACTGCTGTTCCTACAGGACAAG - UNI6158 - CTAAGCATTGAGGATTTCACAGCATACGGTGGTGTGTTTGGAAATAAGCAGGACAGTGC

CTTTTCTAACCTGGAG AATGCCCTGGACTTGGCCCCCTCCTCACTGGTGCTTCCTGCTGTGGACTGGTATGCAATCAGCACTCTGACCACCTACCTACA

GGAGAAGCTTGGGGCTAGCCCCTTGCATGTGGATCTAGCTACCTTAAAGGAGCTGAAGCTCAATGCCAGCCTTCCTGCCCTGCTGCTCATCCGTCTGCCC

TACACAGCCAG CTCCGGTCTGATGGCGCCCAGGGAGGTCCTCACAGGTAACG ATGAGGTCATCGGACAGGTACTGAGCACACTCAAGTCTGAAGATGT

CCCTTACACCGCAGCTCTTACTGCAGTCCGCCCTTCTAGA GTGGCCCGTGATATAACCATGGTGGCTGGGGGTCTAGGTCGCCAGCTGCTTCAGACTCA

GGTGGCATCTCCTGCGATCCATCCTCCTGTGAGTTACAATGACACTGCCCCAAGGATCCTGTTTTGGGCACAAAACTTCTCTGTGGCATACAAAGACGAG

TGGAAAGACTTGACCTCCCTCACCTTTGGTGTGGAGAATCTTAACTTGACCGGCTCCTTCTGGAATGACTCCTTTGCCAT GCTTTCACTGACCTATGAG

CCACTCTTTGGTGCAACAGTGACATTCAA GTTCATTCTGGCTAGTCGCTTCTATCCAGTGTCTGCCCGATATTGGTTTGCCATGGAACGACTTGAAATC

CACAGCAATGGCTCTGTTGCCCATTTCAATGTTTCCCAAGTCACAGGACCTAGCATCTATTCTTTCCACTGTGAGTACGTCAGCAGTGTGAGCAAGAAAG

GCAATCTCCTTGTGACCAACGTGCCCTCAGTCTGGCAGATGACTCTTCATAACTTCCAG ATCCAGGCCTTCAATGTGACTGGTGAACAGTTCTCCTATG

CTAGCGACTGTGCTGGTTTCTTCTCTCCGGGCATCTGGATGGGTCTGCTCACCACCCTCTTCATGCTTTTCATATTCACCTATGGTCTGCACATGATACT

CAGCCTAAAGACCATGGATCGCTTTGATGACCACAAGGGCCCCACCATCACTTTGACCCAGATTGTGTGACATACACCTGAGAGGAATTGAGGGAGTATT

GGTGTCTAGGTTGTCATGTTTCTGTTTTGTGACACAGTGGATGGAAAGGTTTGTCCTCTTCCTACTATAGCATGAACCCTACATACGCCACCCTCAGTCT

CTCTTGCTTCCTCTTTAACCCGGAGAGGGACTCCCCTGTGGCTATCCCCCATCTCTACCAACAAAGTGTATTCTTCATAGATATTAGATAAATCTTCCAG

GCTTCATCATCAAGAGGGGAAGGGACCTTAATTCTAGGGTCTCCCCTTTACCCTCTCTCCTTATTTATTCTTGCCCCTCTGCTATTATTCCTTGCTGTTT

ATAGTGCTTTTGTGTAGTAAATGCTCACTCCCCAAGCTTTATGGAGCTTCCAGCAACAGCCATGAACTTGAGGTTCCTTGAATTTGCGAGGTGTGGAAAG

ACTACTTGACTGTCTGTCCAGCTTAGCTGTTATGTTTTTTGGGGGGGAGGGGTGATGTGTTAAGAGTGAGTGGTACACTGGGGTTTATTTCTGTGGCCTG

GGAAGGAAGAAACCATCACGAGGATTGGTGAACAAAGTGTGCTCACTGGGTTTCTGGATTATTCCCATAAAGACTGCCTGTCAAGAGGCCGGAGGTGTGT

GTGGGGGGTTGCTCTGTTGTTTCCTTCCTAATAAAATAAAGACGTGTTGCCTTG
Translation
MMAATVVSRIRTGTGRAPVMWLSLSLVAVAAAVATEQQVPLVLWSSDR - UNI6158 - - UNI19508 - RNLWAPVADTHEGHITSDMQLSTYLD

PALELGPRNVLLFLQDK - UNI6158 - LSIEDFTAYGGVFGNKQDSAFSNLE NALDLAPSSLVLPAVDWYAISTLTTYLQEKLGASPLHVDLATLK

ELKLNASLPALLLIRLPYTAS SSGLMAPREVLTGND DEVIGQVLSTLKSEDVPYTAALTAVRPSR VARDITMVAGGLGRQLLQTQVASPAIHPPVSY

NDTAPRILFWAQNFSVAYKDEWKDLTSLTFGVENLNLTGSFWNDSFAM MLSLTYEPLFGATVTFK KFILASRFYPVSARYWFAMERLEIHSNGSVAHF

NVSQVTGPSIYSFHCEYVSSVSKKGNLLVTNVPSVWQMTLHNFQ IQAFNVTGEQFSYASDCAGFFSPGIWMGLLTTLFMLFIFTYGLHMILSLKTMDRF

DDHKGPTITLTQIV

For any suggestions or comments, please send an email to unitrap@crg.es